Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2F542

Protein Details
Accession A0A1Y2F542    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-89YEKPSDKRGRLSRERHRKRFLLBasic
NLS Segment(s)
PositionSequence
73-87DKRGRLSRERHRKRF
Subcellular Location(s) nucl 9.5cyto_nucl 9.5, mito 9, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MALPSLFKDEPITPTLNSRNAPSRGPFASYSGRTKTVMQGDIQGAFRQLGSVLRQNNVMREFRQQKFYEKPSDKRGRLSRERHRKRFLLGVRRLVGLVKEQRKFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.34
4 0.32
5 0.33
6 0.38
7 0.38
8 0.4
9 0.36
10 0.36
11 0.32
12 0.35
13 0.32
14 0.28
15 0.32
16 0.32
17 0.34
18 0.32
19 0.33
20 0.31
21 0.31
22 0.32
23 0.3
24 0.28
25 0.24
26 0.24
27 0.23
28 0.23
29 0.23
30 0.18
31 0.14
32 0.12
33 0.11
34 0.08
35 0.07
36 0.07
37 0.08
38 0.12
39 0.13
40 0.13
41 0.17
42 0.17
43 0.21
44 0.22
45 0.22
46 0.19
47 0.27
48 0.34
49 0.32
50 0.39
51 0.37
52 0.41
53 0.46
54 0.5
55 0.52
56 0.51
57 0.54
58 0.58
59 0.66
60 0.62
61 0.64
62 0.68
63 0.67
64 0.7
65 0.74
66 0.74
67 0.76
68 0.85
69 0.85
70 0.85
71 0.79
72 0.74
73 0.74
74 0.72
75 0.72
76 0.68
77 0.68
78 0.62
79 0.59
80 0.55
81 0.46
82 0.38
83 0.36
84 0.38
85 0.37