Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FQF6

Protein Details
Accession A0A1Y2FQF6    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-28FVNAKQYHRILKRRQARAKLEHydrophilic
NLS Segment(s)
PositionSequence
18-54LKRRQARAKLEESIKALKAKPYLHESRHKHAMRRPRG
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018362  CCAAT-binding_factor_CS  
IPR001289  NFYA  
Gene Ontology GO:0016602  C:CCAAT-binding factor complex  
GO:0003677  F:DNA binding  
GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF02045  CBFB_NFYA  
PROSITE View protein in PROSITE  
PS00686  NFYA_HAP2_1  
PS51152  NFYA_HAP2_2  
Amino Acid Sequences PTEDDPLFVNAKQYHRILKRRQARAKLEESIKALKAKPYLHESRHKHAMRRPRGASGRFLTASEIAALKEQEDQSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.44
3 0.53
4 0.56
5 0.61
6 0.68
7 0.74
8 0.8
9 0.8
10 0.8
11 0.78
12 0.74
13 0.71
14 0.63
15 0.56
16 0.5
17 0.44
18 0.38
19 0.33
20 0.28
21 0.25
22 0.26
23 0.24
24 0.24
25 0.27
26 0.31
27 0.33
28 0.42
29 0.44
30 0.46
31 0.55
32 0.55
33 0.53
34 0.54
35 0.59
36 0.59
37 0.63
38 0.59
39 0.58
40 0.63
41 0.6
42 0.62
43 0.54
44 0.51
45 0.42
46 0.4
47 0.34
48 0.27
49 0.25
50 0.19
51 0.17
52 0.11
53 0.13
54 0.13
55 0.11
56 0.16