Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EZM3

Protein Details
Accession A0A1Y2EZM3   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
58-83DKKRAAGKLLKRKWRLRGQKHSLWVAHydrophilic
NLS Segment(s)
PositionSequence
55-76KGLDKKRAAGKLLKRKWRLRGQ
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 2.5
Family & Domain DBs
Amino Acid Sequences SYGKFSICLNTIAGIKVLKTKLSCGARSLSKQGHILQAIVLVCRLLESTGQYERKGLDKKRAAGKLLKRKWRLRGQKHSLWVAEGYQIQYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.18
4 0.18
5 0.19
6 0.18
7 0.2
8 0.27
9 0.32
10 0.33
11 0.29
12 0.33
13 0.34
14 0.36
15 0.4
16 0.34
17 0.31
18 0.33
19 0.32
20 0.32
21 0.28
22 0.25
23 0.19
24 0.19
25 0.16
26 0.13
27 0.11
28 0.07
29 0.06
30 0.06
31 0.06
32 0.03
33 0.04
34 0.05
35 0.08
36 0.14
37 0.15
38 0.15
39 0.16
40 0.17
41 0.23
42 0.29
43 0.29
44 0.33
45 0.38
46 0.44
47 0.52
48 0.55
49 0.52
50 0.53
51 0.6
52 0.61
53 0.64
54 0.68
55 0.68
56 0.72
57 0.78
58 0.81
59 0.82
60 0.81
61 0.84
62 0.83
63 0.82
64 0.82
65 0.78
66 0.69
67 0.6
68 0.5
69 0.4
70 0.35
71 0.29