Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FBL0

Protein Details
Accession A0A1Y2FBL0   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
61-81AASQAKKARKSAKKAKKAAAPHydrophilic
NLS Segment(s)
PositionSequence
63-78SQAKKARKSAKKAKKA
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036866  RibonucZ/Hydroxyglut_hydro  
Amino Acid Sequences MHMFPRQVRPIFDVIRLTSGQKSSKDRSASSSRKSGRTSKLSRRAQDAEQGSTTMTKAKTAASQAKKARKSAKKAKKAAAPLLVQHIQQSSLRFTVDAVAIQDSDPALGFVFSGADFVEITQQTSSTLMAAFCNANAERRATLSALKAGHAISLPTGSTLSDTLVSVRERAANRGHSKPGVAGALASACQAKILVLTHFSSRYGGKGQQARHCMRLCEQIAQQASSATQETLELLFADDSQRKGPAAVSHSAKQRNGAMAFYGYKGKVIAASDGIMLDIPRPRVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.38
3 0.36
4 0.33
5 0.3
6 0.32
7 0.33
8 0.35
9 0.41
10 0.42
11 0.49
12 0.51
13 0.48
14 0.51
15 0.57
16 0.59
17 0.58
18 0.62
19 0.6
20 0.62
21 0.66
22 0.67
23 0.65
24 0.67
25 0.71
26 0.72
27 0.76
28 0.78
29 0.77
30 0.76
31 0.72
32 0.64
33 0.63
34 0.56
35 0.49
36 0.42
37 0.38
38 0.3
39 0.27
40 0.24
41 0.21
42 0.17
43 0.14
44 0.14
45 0.15
46 0.18
47 0.24
48 0.33
49 0.34
50 0.42
51 0.49
52 0.58
53 0.61
54 0.64
55 0.67
56 0.67
57 0.71
58 0.74
59 0.77
60 0.78
61 0.82
62 0.82
63 0.79
64 0.77
65 0.73
66 0.69
67 0.59
68 0.51
69 0.49
70 0.44
71 0.36
72 0.31
73 0.25
74 0.2
75 0.2
76 0.2
77 0.16
78 0.15
79 0.15
80 0.13
81 0.13
82 0.13
83 0.12
84 0.11
85 0.09
86 0.09
87 0.09
88 0.09
89 0.09
90 0.07
91 0.06
92 0.06
93 0.05
94 0.04
95 0.04
96 0.04
97 0.03
98 0.04
99 0.03
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.07
106 0.07
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.05
114 0.06
115 0.05
116 0.05
117 0.06
118 0.06
119 0.05
120 0.08
121 0.08
122 0.09
123 0.1
124 0.11
125 0.1
126 0.11
127 0.12
128 0.1
129 0.12
130 0.11
131 0.14
132 0.13
133 0.13
134 0.13
135 0.11
136 0.11
137 0.1
138 0.09
139 0.05
140 0.06
141 0.05
142 0.05
143 0.05
144 0.04
145 0.05
146 0.05
147 0.05
148 0.06
149 0.06
150 0.06
151 0.09
152 0.09
153 0.09
154 0.09
155 0.14
156 0.14
157 0.17
158 0.2
159 0.25
160 0.3
161 0.33
162 0.35
163 0.31
164 0.31
165 0.28
166 0.26
167 0.19
168 0.14
169 0.11
170 0.08
171 0.08
172 0.07
173 0.07
174 0.05
175 0.04
176 0.05
177 0.05
178 0.04
179 0.05
180 0.06
181 0.07
182 0.09
183 0.1
184 0.12
185 0.13
186 0.13
187 0.14
188 0.13
189 0.15
190 0.16
191 0.18
192 0.23
193 0.28
194 0.33
195 0.38
196 0.46
197 0.47
198 0.51
199 0.5
200 0.46
201 0.44
202 0.47
203 0.42
204 0.38
205 0.36
206 0.36
207 0.35
208 0.34
209 0.31
210 0.22
211 0.2
212 0.17
213 0.17
214 0.1
215 0.09
216 0.08
217 0.09
218 0.09
219 0.09
220 0.07
221 0.07
222 0.07
223 0.07
224 0.11
225 0.13
226 0.14
227 0.15
228 0.16
229 0.16
230 0.16
231 0.18
232 0.2
233 0.22
234 0.27
235 0.31
236 0.36
237 0.43
238 0.49
239 0.47
240 0.45
241 0.44
242 0.44
243 0.4
244 0.36
245 0.3
246 0.28
247 0.28
248 0.26
249 0.27
250 0.21
251 0.2
252 0.2
253 0.18
254 0.17
255 0.17
256 0.18
257 0.14
258 0.15
259 0.15
260 0.14
261 0.14
262 0.12
263 0.1
264 0.11
265 0.14
266 0.15