Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NUL7

Protein Details
Accession G9NUL7    Localization Confidence Low Confidence Score 5.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRRANRKLKTKEKKEWNPATYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, golg 5, plas 3, E.R. 3, extr 2, nucl 1, cyto 1, cyto_nucl 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR035213  DUF5321  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF17254  DUF5321  
Amino Acid Sequences MRRANRKLKTKEKKEWNPATYFIVMFLFIGSMSIQMIALRNQTDRYMRQSSLRIAQLREVVQRIQNGEDVDVERILGTGDPQKETEWEEVLQAIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.85
4 0.78
5 0.7
6 0.64
7 0.55
8 0.44
9 0.34
10 0.24
11 0.18
12 0.14
13 0.12
14 0.07
15 0.05
16 0.05
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.06
24 0.06
25 0.07
26 0.08
27 0.09
28 0.1
29 0.12
30 0.14
31 0.15
32 0.2
33 0.23
34 0.22
35 0.25
36 0.27
37 0.27
38 0.29
39 0.32
40 0.28
41 0.25
42 0.26
43 0.27
44 0.26
45 0.26
46 0.23
47 0.19
48 0.2
49 0.21
50 0.2
51 0.18
52 0.19
53 0.17
54 0.16
55 0.16
56 0.15
57 0.14
58 0.13
59 0.12
60 0.09
61 0.08
62 0.08
63 0.07
64 0.07
65 0.12
66 0.14
67 0.16
68 0.17
69 0.18
70 0.19
71 0.23
72 0.24
73 0.2
74 0.19
75 0.18