Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FRD2

Protein Details
Accession A0A1Y2FRD2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKVSHDVTSSRRKQRKQHFAAPSSERHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKVSHDVTSSRRKQRKQHFAAPSSERRIRMSAPLSKEMRTKFAVKSLPIRINDEVKVTRGSHKGKEGKVVSVYRKKYVIHIERVTREKVNGASVPVGVDASKVEITNVATNKDRSDLIVRKGGKAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.85
3 0.83
4 0.84
5 0.84
6 0.8
7 0.8
8 0.77
9 0.74
10 0.71
11 0.67
12 0.59
13 0.51
14 0.49
15 0.43
16 0.42
17 0.41
18 0.39
19 0.39
20 0.45
21 0.44
22 0.43
23 0.47
24 0.41
25 0.39
26 0.35
27 0.34
28 0.27
29 0.32
30 0.33
31 0.3
32 0.35
33 0.38
34 0.4
35 0.38
36 0.41
37 0.37
38 0.36
39 0.35
40 0.32
41 0.26
42 0.21
43 0.22
44 0.19
45 0.21
46 0.25
47 0.27
48 0.26
49 0.33
50 0.37
51 0.35
52 0.42
53 0.39
54 0.35
55 0.36
56 0.38
57 0.37
58 0.39
59 0.4
60 0.35
61 0.37
62 0.35
63 0.35
64 0.41
65 0.4
66 0.41
67 0.44
68 0.46
69 0.5
70 0.53
71 0.51
72 0.42
73 0.36
74 0.31
75 0.27
76 0.26
77 0.21
78 0.2
79 0.17
80 0.16
81 0.16
82 0.13
83 0.12
84 0.08
85 0.07
86 0.06
87 0.08
88 0.08
89 0.08
90 0.08
91 0.09
92 0.12
93 0.17
94 0.19
95 0.2
96 0.23
97 0.24
98 0.25
99 0.26
100 0.24
101 0.22
102 0.29
103 0.32
104 0.33
105 0.4
106 0.41
107 0.42