Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F3U3

Protein Details
Accession A0A1Y2F3U3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-37ELEARKTRGRTHKRVRQETGPBasic
NLS Segment(s)
PositionSequence
22-29KTRGRTHK
Subcellular Location(s) nucl 13, mito 10.5, cyto_mito 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKNKAAEGCPFIFIRRELEARKTRGRTHKRVRQETGPKYQRLWATSSQTREETRDVSNWSGENKRLEPEESKQLVEDAERVAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.26
4 0.26
5 0.35
6 0.42
7 0.45
8 0.52
9 0.53
10 0.57
11 0.63
12 0.7
13 0.71
14 0.74
15 0.77
16 0.79
17 0.83
18 0.8
19 0.79
20 0.8
21 0.76
22 0.76
23 0.73
24 0.64
25 0.56
26 0.56
27 0.48
28 0.39
29 0.36
30 0.29
31 0.3
32 0.32
33 0.34
34 0.32
35 0.32
36 0.32
37 0.31
38 0.29
39 0.24
40 0.22
41 0.23
42 0.23
43 0.22
44 0.23
45 0.21
46 0.23
47 0.24
48 0.26
49 0.27
50 0.26
51 0.27
52 0.28
53 0.3
54 0.31
55 0.32
56 0.39
57 0.37
58 0.36
59 0.33
60 0.32
61 0.3
62 0.26
63 0.23