Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FR52

Protein Details
Accession A0A1Y2FR52   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
35-58FGREYDKHKGKPRKASLHIKPTPKBasic
NLS Segment(s)
PositionSequence
41-60KHKGKPRKASLHIKPTPKQR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031415  Rrg8  
IPR035931  YlxR-like_sf  
Gene Ontology GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF17068  RRG8  
Amino Acid Sequences MSSVGPSADVLTELLRPSKLPDSIKERPKQESFIFGREYDKHKGKPRKASLHIKPTPKQRHALAQLSNEDKSRRKQLRDNKHAQILASPVRLCAYTRTRMPRALMIPLSLCPHPSNKDEDWIMPDFERKVPGKHVYVTNSSKILEALGSGKNAWKRLQIEDDEPLSTRKVVWRPDMIEHVKREMVRCKWLVQELYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.17
5 0.22
6 0.27
7 0.28
8 0.34
9 0.41
10 0.5
11 0.59
12 0.61
13 0.6
14 0.62
15 0.62
16 0.61
17 0.54
18 0.55
19 0.49
20 0.47
21 0.46
22 0.39
23 0.4
24 0.38
25 0.42
26 0.4
27 0.43
28 0.45
29 0.53
30 0.62
31 0.66
32 0.72
33 0.77
34 0.79
35 0.81
36 0.84
37 0.83
38 0.84
39 0.82
40 0.79
41 0.75
42 0.76
43 0.77
44 0.7
45 0.66
46 0.57
47 0.6
48 0.59
49 0.59
50 0.53
51 0.47
52 0.47
53 0.45
54 0.44
55 0.36
56 0.33
57 0.3
58 0.3
59 0.37
60 0.38
61 0.41
62 0.49
63 0.57
64 0.65
65 0.72
66 0.75
67 0.69
68 0.68
69 0.63
70 0.55
71 0.46
72 0.38
73 0.3
74 0.24
75 0.2
76 0.14
77 0.14
78 0.14
79 0.13
80 0.15
81 0.17
82 0.18
83 0.23
84 0.29
85 0.31
86 0.33
87 0.33
88 0.32
89 0.3
90 0.29
91 0.25
92 0.2
93 0.18
94 0.17
95 0.18
96 0.14
97 0.13
98 0.11
99 0.13
100 0.16
101 0.17
102 0.22
103 0.2
104 0.24
105 0.24
106 0.24
107 0.25
108 0.23
109 0.23
110 0.17
111 0.18
112 0.16
113 0.16
114 0.2
115 0.18
116 0.18
117 0.23
118 0.27
119 0.28
120 0.3
121 0.33
122 0.32
123 0.38
124 0.4
125 0.37
126 0.33
127 0.31
128 0.28
129 0.24
130 0.2
131 0.12
132 0.1
133 0.1
134 0.1
135 0.11
136 0.11
137 0.15
138 0.17
139 0.2
140 0.21
141 0.24
142 0.25
143 0.3
144 0.36
145 0.36
146 0.36
147 0.38
148 0.39
149 0.34
150 0.32
151 0.28
152 0.23
153 0.2
154 0.18
155 0.2
156 0.24
157 0.29
158 0.34
159 0.39
160 0.42
161 0.46
162 0.54
163 0.54
164 0.54
165 0.52
166 0.5
167 0.47
168 0.46
169 0.47
170 0.47
171 0.45
172 0.47
173 0.46
174 0.45
175 0.47
176 0.52