Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2ES40

Protein Details
Accession A0A1Y2ES40    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
31-53NKKVLKTVKKAAKQKHIKRGVKEBasic
NLS Segment(s)
PositionSequence
28-61KKLNKKVLKTVKKAAKQKHIKRGVKEVVKALRKK
Subcellular Location(s) cyto 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
Amino Acid Sequences KESAGDEADAYDIKAAHVIAIAQPLASKKLNKKVLKTVKKAAKQKHIKRGVKEVVKALRKKESSADKALVVIAGDISPIDVISHIPVLCEDHGIKYIYTPGKEELGAAGGTKRPTSVIMVQLGGKAKDGKEGDYKEAFEEILKELE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.08
5 0.08
6 0.08
7 0.1
8 0.1
9 0.08
10 0.1
11 0.11
12 0.14
13 0.16
14 0.21
15 0.26
16 0.36
17 0.46
18 0.5
19 0.54
20 0.62
21 0.7
22 0.74
23 0.73
24 0.73
25 0.73
26 0.76
27 0.79
28 0.77
29 0.77
30 0.78
31 0.8
32 0.81
33 0.83
34 0.8
35 0.76
36 0.77
37 0.75
38 0.69
39 0.62
40 0.58
41 0.55
42 0.57
43 0.56
44 0.49
45 0.48
46 0.44
47 0.42
48 0.43
49 0.43
50 0.41
51 0.42
52 0.4
53 0.32
54 0.31
55 0.3
56 0.23
57 0.14
58 0.09
59 0.05
60 0.03
61 0.03
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.04
70 0.05
71 0.05
72 0.05
73 0.06
74 0.07
75 0.07
76 0.09
77 0.09
78 0.08
79 0.11
80 0.12
81 0.11
82 0.1
83 0.16
84 0.17
85 0.18
86 0.19
87 0.18
88 0.18
89 0.19
90 0.18
91 0.13
92 0.12
93 0.11
94 0.09
95 0.09
96 0.1
97 0.11
98 0.11
99 0.11
100 0.1
101 0.11
102 0.15
103 0.18
104 0.2
105 0.21
106 0.22
107 0.22
108 0.25
109 0.26
110 0.22
111 0.2
112 0.19
113 0.17
114 0.24
115 0.24
116 0.25
117 0.31
118 0.34
119 0.38
120 0.39
121 0.39
122 0.33
123 0.33
124 0.29
125 0.22
126 0.2