Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FPB1

Protein Details
Accession A0A1Y2FPB1    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-106IEHTKQPMLRTIKKKRRNRHAKLVESKQPYHydrophilic
NLS Segment(s)
PositionSequence
88-98IKKKRRNRHAK
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MAALRLQPRQFAKMRIDGKAYTITNGDVIHLPTRLKNTSVGDTLRLTHAIMVGSRDFTIRGQPFVKEDLFECSATVIEHTKQPMLRTIKKKRRNRHAKLVESKQPYTVLRINKIQIHEPTAVTDRKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.49
4 0.42
5 0.41
6 0.42
7 0.37
8 0.29
9 0.26
10 0.22
11 0.2
12 0.19
13 0.18
14 0.12
15 0.14
16 0.14
17 0.14
18 0.15
19 0.15
20 0.2
21 0.2
22 0.2
23 0.22
24 0.23
25 0.25
26 0.28
27 0.26
28 0.24
29 0.23
30 0.23
31 0.2
32 0.17
33 0.14
34 0.11
35 0.11
36 0.09
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.15
46 0.13
47 0.16
48 0.16
49 0.16
50 0.18
51 0.2
52 0.19
53 0.13
54 0.13
55 0.15
56 0.16
57 0.15
58 0.14
59 0.11
60 0.11
61 0.11
62 0.11
63 0.09
64 0.08
65 0.1
66 0.11
67 0.13
68 0.14
69 0.15
70 0.22
71 0.28
72 0.36
73 0.44
74 0.54
75 0.62
76 0.71
77 0.8
78 0.83
79 0.87
80 0.9
81 0.88
82 0.89
83 0.88
84 0.89
85 0.89
86 0.87
87 0.84
88 0.8
89 0.72
90 0.63
91 0.56
92 0.47
93 0.43
94 0.4
95 0.38
96 0.36
97 0.41
98 0.43
99 0.43
100 0.46
101 0.46
102 0.44
103 0.42
104 0.39
105 0.35
106 0.35
107 0.36
108 0.36