Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2FA57

Protein Details
Accession A0A1Y2FA57    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
91-115YTLQSLPQSKKKRGKRTIKDRFVDLHydrophilic
NLS Segment(s)
PositionSequence
100-107KKKRGKRT
Subcellular Location(s) extr 24, mito 1, cyto 1, plas 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018805  YJL171C/Tos1_C  
IPR018807  YJL171C/Tos1_N  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF10287  YJL171C_Tos1_C  
PF10290  YJL171C_Tos1_N  
Amino Acid Sequences MLFQLATLLTIAAASNCVNEGGNWYCDQTSQITFSGLGGTPGSYDRVSNMDPETCTCSKTPQPFSGPLSPLDEDLSLHFRGPIAIKQFAAYTLQSLPQSKKKRGKRTIKDRFVDLFRREQVVYTLIPPISSRYAASTPVAVAYPTETPVAVVPTPAPSAPTTTAAAIVPPVSTPTQVGTSSSWQRSSYYNAQSATLQNAVFMNNMGGVNGSGTWSPCFGNSVSFASASGMGSAPNPEVLQDITLPSNTEVILFSGEQCTTATCGYVAPGVPAYRGFSGQNKIFLFEFSMPLDGDRGFNGDMPAIWALNGQIPRSQQYGGCSCWQTGCGELDLFETLSAGSERMIATFHSRPGQGGSTPNWIQRPTGGSMKAAVVFLGGSKTIKLIHLADSVNFEGGLSQSLVDSWDLSGATAVSLVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.09
6 0.08
7 0.14
8 0.16
9 0.18
10 0.18
11 0.2
12 0.19
13 0.19
14 0.21
15 0.2
16 0.19
17 0.2
18 0.2
19 0.19
20 0.19
21 0.19
22 0.2
23 0.17
24 0.15
25 0.12
26 0.12
27 0.11
28 0.12
29 0.15
30 0.11
31 0.11
32 0.12
33 0.16
34 0.16
35 0.18
36 0.2
37 0.21
38 0.22
39 0.24
40 0.3
41 0.26
42 0.28
43 0.25
44 0.29
45 0.33
46 0.41
47 0.45
48 0.45
49 0.5
50 0.53
51 0.59
52 0.61
53 0.55
54 0.48
55 0.46
56 0.4
57 0.34
58 0.3
59 0.24
60 0.17
61 0.18
62 0.19
63 0.15
64 0.14
65 0.14
66 0.13
67 0.15
68 0.16
69 0.18
70 0.2
71 0.21
72 0.21
73 0.22
74 0.22
75 0.21
76 0.21
77 0.16
78 0.14
79 0.13
80 0.16
81 0.17
82 0.21
83 0.25
84 0.32
85 0.4
86 0.47
87 0.56
88 0.63
89 0.72
90 0.79
91 0.85
92 0.87
93 0.9
94 0.92
95 0.92
96 0.85
97 0.79
98 0.74
99 0.69
100 0.66
101 0.58
102 0.54
103 0.46
104 0.46
105 0.4
106 0.36
107 0.31
108 0.25
109 0.23
110 0.17
111 0.18
112 0.15
113 0.15
114 0.14
115 0.16
116 0.15
117 0.15
118 0.14
119 0.14
120 0.15
121 0.17
122 0.17
123 0.15
124 0.13
125 0.13
126 0.13
127 0.09
128 0.08
129 0.08
130 0.08
131 0.08
132 0.09
133 0.07
134 0.08
135 0.08
136 0.11
137 0.09
138 0.08
139 0.08
140 0.09
141 0.1
142 0.09
143 0.1
144 0.08
145 0.11
146 0.12
147 0.14
148 0.13
149 0.13
150 0.14
151 0.12
152 0.12
153 0.09
154 0.08
155 0.06
156 0.05
157 0.07
158 0.06
159 0.07
160 0.07
161 0.08
162 0.1
163 0.1
164 0.11
165 0.11
166 0.16
167 0.21
168 0.22
169 0.22
170 0.21
171 0.22
172 0.22
173 0.27
174 0.3
175 0.29
176 0.31
177 0.29
178 0.3
179 0.3
180 0.29
181 0.24
182 0.19
183 0.14
184 0.11
185 0.11
186 0.11
187 0.09
188 0.09
189 0.07
190 0.06
191 0.06
192 0.05
193 0.05
194 0.04
195 0.04
196 0.04
197 0.05
198 0.04
199 0.05
200 0.05
201 0.06
202 0.06
203 0.06
204 0.08
205 0.07
206 0.08
207 0.09
208 0.11
209 0.11
210 0.1
211 0.11
212 0.1
213 0.1
214 0.09
215 0.08
216 0.06
217 0.05
218 0.06
219 0.06
220 0.06
221 0.06
222 0.06
223 0.05
224 0.06
225 0.06
226 0.06
227 0.06
228 0.07
229 0.07
230 0.07
231 0.08
232 0.07
233 0.08
234 0.07
235 0.07
236 0.06
237 0.06
238 0.07
239 0.07
240 0.07
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.08
247 0.08
248 0.07
249 0.06
250 0.06
251 0.06
252 0.08
253 0.07
254 0.06
255 0.08
256 0.08
257 0.08
258 0.09
259 0.1
260 0.1
261 0.11
262 0.12
263 0.15
264 0.2
265 0.22
266 0.27
267 0.25
268 0.26
269 0.25
270 0.24
271 0.23
272 0.18
273 0.18
274 0.13
275 0.14
276 0.12
277 0.12
278 0.13
279 0.1
280 0.1
281 0.08
282 0.1
283 0.09
284 0.1
285 0.1
286 0.09
287 0.09
288 0.1
289 0.1
290 0.08
291 0.08
292 0.07
293 0.07
294 0.11
295 0.12
296 0.11
297 0.14
298 0.15
299 0.18
300 0.19
301 0.2
302 0.18
303 0.22
304 0.25
305 0.25
306 0.28
307 0.27
308 0.26
309 0.25
310 0.25
311 0.2
312 0.19
313 0.18
314 0.14
315 0.13
316 0.13
317 0.13
318 0.13
319 0.12
320 0.09
321 0.08
322 0.06
323 0.07
324 0.07
325 0.06
326 0.06
327 0.07
328 0.07
329 0.08
330 0.08
331 0.08
332 0.14
333 0.17
334 0.2
335 0.22
336 0.22
337 0.23
338 0.26
339 0.27
340 0.24
341 0.26
342 0.26
343 0.3
344 0.32
345 0.36
346 0.36
347 0.34
348 0.32
349 0.31
350 0.33
351 0.29
352 0.33
353 0.3
354 0.28
355 0.29
356 0.3
357 0.28
358 0.24
359 0.19
360 0.12
361 0.11
362 0.11
363 0.1
364 0.09
365 0.08
366 0.08
367 0.1
368 0.11
369 0.12
370 0.15
371 0.15
372 0.18
373 0.23
374 0.24
375 0.24
376 0.27
377 0.27
378 0.24
379 0.22
380 0.17
381 0.13
382 0.12
383 0.13
384 0.09
385 0.08
386 0.08
387 0.08
388 0.09
389 0.09
390 0.09
391 0.08
392 0.09
393 0.09
394 0.09
395 0.1
396 0.08
397 0.08