Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FQC8

Protein Details
Accession A0A1Y2FQC8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-28ASKPHVPIVKKRLQRFKRFQSDRFLRHydrophilic
30-50AESWRKPKGIDNRQRRRFKGSBasic
NLS Segment(s)
PositionSequence
32-49SWRKPKGIDNRQRRRFKG
Subcellular Location(s) mito 17.5, mito_nucl 12, nucl 5.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASKPHVPIVKKRLQRFKRFQSDRFLRVAESWRKPKGIDNRQRRRFKGSAPMPSIGYGSNKKTKHMSASGHKTFLVRNVADVELLLMHARSYAAEIAHNVSSRKRIEIVAKAKQLNVKVTNDKAKVRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.82
4 0.83
5 0.85
6 0.87
7 0.86
8 0.81
9 0.81
10 0.8
11 0.73
12 0.66
13 0.56
14 0.46
15 0.42
16 0.46
17 0.44
18 0.44
19 0.47
20 0.46
21 0.47
22 0.46
23 0.51
24 0.53
25 0.55
26 0.57
27 0.61
28 0.69
29 0.78
30 0.86
31 0.81
32 0.78
33 0.7
34 0.64
35 0.64
36 0.6
37 0.59
38 0.54
39 0.53
40 0.45
41 0.42
42 0.38
43 0.28
44 0.24
45 0.18
46 0.18
47 0.24
48 0.24
49 0.25
50 0.27
51 0.28
52 0.29
53 0.31
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.36
61 0.31
62 0.3
63 0.27
64 0.17
65 0.17
66 0.18
67 0.17
68 0.17
69 0.16
70 0.12
71 0.07
72 0.07
73 0.06
74 0.04
75 0.03
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.07
82 0.07
83 0.08
84 0.11
85 0.13
86 0.15
87 0.14
88 0.15
89 0.21
90 0.21
91 0.23
92 0.22
93 0.24
94 0.28
95 0.37
96 0.43
97 0.46
98 0.51
99 0.51
100 0.52
101 0.53
102 0.5
103 0.48
104 0.45
105 0.44
106 0.44
107 0.49
108 0.56
109 0.56
110 0.59
111 0.55