Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2EWU5

Protein Details
Accession A0A1Y2EWU5    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-37ALDPQHKKIRTENRERKKRWREANEDRNKDNBasic
62-85WIEEEFNKRKHKRQEKEGKGPDGLBasic
NLS Segment(s)
PositionSequence
13-28KKIRTENRERKKRWRE
69-80KRKHKRQEKEGK
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021386  SPP41_DUF3020  
Pfam View protein in Pfam  
PF11223  DUF3020  
Amino Acid Sequences MELDKEALDPQHKKIRTENRERKKRWREANEDRNKDNDLRCRVHKRAHKLYGKENSRMKEMWIEEEFNKRKHKRQEKEGKGPDGLPLID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.6
4 0.68
5 0.73
6 0.74
7 0.83
8 0.86
9 0.88
10 0.88
11 0.87
12 0.87
13 0.85
14 0.85
15 0.85
16 0.9
17 0.89
18 0.84
19 0.76
20 0.68
21 0.6
22 0.53
23 0.47
24 0.43
25 0.39
26 0.37
27 0.42
28 0.47
29 0.49
30 0.53
31 0.54
32 0.56
33 0.59
34 0.64
35 0.64
36 0.6
37 0.65
38 0.67
39 0.65
40 0.63
41 0.59
42 0.51
43 0.48
44 0.45
45 0.38
46 0.34
47 0.31
48 0.3
49 0.27
50 0.28
51 0.26
52 0.36
53 0.39
54 0.38
55 0.47
56 0.46
57 0.52
58 0.6
59 0.7
60 0.69
61 0.76
62 0.83
63 0.83
64 0.9
65 0.9
66 0.85
67 0.77
68 0.67
69 0.59