Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2F5H0

Protein Details
Accession A0A1Y2F5H0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTVKRRNNGRNKSGRGHVKPBasic
81-112SKVVRVRSRTGRRVRTPPPRVRFNKDGKKINPHydrophilic
NLS Segment(s)
PositionSequence
87-110RSRTGRRVRTPPPRVRFNKDGKKI
Subcellular Location(s) mito 12.5, mito_nucl 12, nucl 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTVKRRNNGRNKSGRGHVKPVRCSNCSRCVPKDKAIKRFTVRNMVESAAIRDISEASVYQEYALPKLYNKLHYCISCAIHSKVVRVRSRTGRRVRTPPPRVRFNKDGKKINPAAAAKVVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.76
4 0.72
5 0.7
6 0.72
7 0.75
8 0.73
9 0.66
10 0.67
11 0.64
12 0.67
13 0.66
14 0.64
15 0.61
16 0.63
17 0.65
18 0.66
19 0.7
20 0.68
21 0.7
22 0.67
23 0.67
24 0.62
25 0.64
26 0.6
27 0.6
28 0.53
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.09
52 0.09
53 0.14
54 0.16
55 0.21
56 0.22
57 0.24
58 0.27
59 0.27
60 0.3
61 0.29
62 0.28
63 0.24
64 0.26
65 0.25
66 0.27
67 0.27
68 0.28
69 0.29
70 0.35
71 0.38
72 0.38
73 0.43
74 0.48
75 0.57
76 0.62
77 0.68
78 0.69
79 0.72
80 0.78
81 0.8
82 0.81
83 0.82
84 0.83
85 0.81
86 0.82
87 0.81
88 0.81
89 0.81
90 0.8
91 0.81
92 0.8
93 0.82
94 0.75
95 0.77
96 0.72
97 0.68
98 0.66
99 0.57
100 0.51