Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EZH8

Protein Details
Accession A0A1Y2EZH8   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-98YCPLGPDCKRKHIRRKPCMCYLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045348  CPSF4/Yth1  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0098789  P:pre-mRNA cleavage required for polyadenylation  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MAQRVQTSTSMPLRTIDKGDSSLLSASTGCVVYMRHVQECKQWKVQGTCGNAEDCLYAHPALGSRNGVCDWYKLGYCPLGPDCKRKHIRRKPCMCYLTGFCPYGLDCKDAHLQFLVPPKAPPVIPMTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.26
4 0.23
5 0.23
6 0.24
7 0.21
8 0.2
9 0.18
10 0.15
11 0.14
12 0.11
13 0.1
14 0.1
15 0.09
16 0.07
17 0.07
18 0.07
19 0.09
20 0.15
21 0.17
22 0.2
23 0.21
24 0.22
25 0.29
26 0.37
27 0.4
28 0.41
29 0.41
30 0.43
31 0.44
32 0.5
33 0.48
34 0.43
35 0.4
36 0.35
37 0.33
38 0.27
39 0.25
40 0.19
41 0.12
42 0.1
43 0.09
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.09
50 0.09
51 0.07
52 0.09
53 0.09
54 0.1
55 0.1
56 0.09
57 0.1
58 0.1
59 0.1
60 0.1
61 0.11
62 0.1
63 0.1
64 0.12
65 0.13
66 0.2
67 0.22
68 0.3
69 0.33
70 0.42
71 0.51
72 0.58
73 0.67
74 0.69
75 0.79
76 0.82
77 0.88
78 0.85
79 0.86
80 0.8
81 0.7
82 0.65
83 0.58
84 0.54
85 0.48
86 0.41
87 0.31
88 0.29
89 0.28
90 0.28
91 0.25
92 0.2
93 0.15
94 0.19
95 0.26
96 0.25
97 0.26
98 0.22
99 0.21
100 0.23
101 0.32
102 0.31
103 0.25
104 0.25
105 0.27
106 0.29
107 0.28
108 0.27
109 0.23