Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2FLA5

Protein Details
Accession A0A1Y2FLA5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-81LCLVLSWSRCRRRRRKCVYAAVTQGHydrophilic
NLS Segment(s)
PositionSequence
90-97GKARGRRR
Subcellular Location(s) plas 9, extr 9, mito 6, cyto 2
Family & Domain DBs
Amino Acid Sequences MRRCWSGGMPSLSWIFDLTLSIVSEDSTSRVMVLPVRVLTKICILGCRLGCAWKGELCLVLSWSRCRRRRRKCVYAAVTQGALEHRSGWGKARGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.15
3 0.1
4 0.11
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.08
11 0.08
12 0.08
13 0.09
14 0.08
15 0.07
16 0.07
17 0.08
18 0.08
19 0.1
20 0.1
21 0.11
22 0.11
23 0.12
24 0.12
25 0.12
26 0.12
27 0.12
28 0.14
29 0.12
30 0.12
31 0.12
32 0.16
33 0.15
34 0.16
35 0.14
36 0.13
37 0.14
38 0.14
39 0.15
40 0.12
41 0.13
42 0.12
43 0.12
44 0.11
45 0.11
46 0.11
47 0.11
48 0.12
49 0.17
50 0.25
51 0.33
52 0.4
53 0.51
54 0.6
55 0.7
56 0.79
57 0.84
58 0.87
59 0.87
60 0.91
61 0.86
62 0.83
63 0.78
64 0.69
65 0.59
66 0.48
67 0.39
68 0.3
69 0.25
70 0.17
71 0.12
72 0.12
73 0.14
74 0.16
75 0.19
76 0.26
77 0.33