Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2EZI4

Protein Details
Accession A0A1Y2EZI4    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
146-176HLWYHSFVRRRRWLRKRRKKQGGHVHRRVDEBasic
NLS Segment(s)
PositionSequence
154-169RRRRWLRKRRKKQGGH
Subcellular Location(s) nucl 10, pero 7, mito_nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006614  Peroxin/Ferlin  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHIPGFGPRQVIEEDRHVIGLEDRLCNATPTEQPQAAHLGLQNSPVGLSAYLSEDTVIDLLCENQRGAFLCGSPMFSSMGLWITDPHAWTTPHGRYTPFNILNATLPDPSWEWTWPRWFVDMSGDVDENGWMYNINFTRHHWHGHHLWYHSFVRRRRWLRKRRKKQGGHVHRRVDETATGYTATVRSAGYETQQGASIMQHLAQIEQEVTVLSNLGDFYTQLRGCRLDREKLEAVDQYLHQGQDLYALAGEVKTILRFMIFQDSRRQLLALLSQHCQELEKEHAVQHEEQAAAADDHDSRHACVADAVDVAELLIAKLDYWSDRQILTRIEEDAELDRIMAVKLDEQAKKRKPPDLDALHVAEDRAENNEVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.29
4 0.26
5 0.24
6 0.22
7 0.24
8 0.22
9 0.2
10 0.2
11 0.22
12 0.23
13 0.23
14 0.22
15 0.2
16 0.21
17 0.25
18 0.31
19 0.31
20 0.31
21 0.31
22 0.35
23 0.31
24 0.29
25 0.25
26 0.22
27 0.2
28 0.22
29 0.2
30 0.15
31 0.15
32 0.13
33 0.12
34 0.09
35 0.09
36 0.08
37 0.1
38 0.11
39 0.1
40 0.1
41 0.09
42 0.1
43 0.09
44 0.08
45 0.06
46 0.06
47 0.08
48 0.09
49 0.11
50 0.1
51 0.1
52 0.12
53 0.14
54 0.16
55 0.15
56 0.13
57 0.16
58 0.16
59 0.18
60 0.17
61 0.16
62 0.14
63 0.13
64 0.13
65 0.11
66 0.12
67 0.1
68 0.1
69 0.09
70 0.11
71 0.12
72 0.13
73 0.14
74 0.15
75 0.15
76 0.17
77 0.24
78 0.26
79 0.29
80 0.3
81 0.3
82 0.29
83 0.35
84 0.43
85 0.38
86 0.35
87 0.31
88 0.31
89 0.31
90 0.31
91 0.26
92 0.16
93 0.14
94 0.14
95 0.14
96 0.15
97 0.14
98 0.14
99 0.15
100 0.19
101 0.24
102 0.25
103 0.26
104 0.26
105 0.24
106 0.23
107 0.25
108 0.24
109 0.21
110 0.2
111 0.19
112 0.17
113 0.16
114 0.16
115 0.11
116 0.08
117 0.06
118 0.04
119 0.04
120 0.09
121 0.11
122 0.13
123 0.14
124 0.16
125 0.23
126 0.25
127 0.29
128 0.26
129 0.29
130 0.31
131 0.36
132 0.39
133 0.34
134 0.33
135 0.33
136 0.36
137 0.37
138 0.39
139 0.37
140 0.41
141 0.49
142 0.57
143 0.63
144 0.7
145 0.76
146 0.8
147 0.88
148 0.9
149 0.92
150 0.94
151 0.92
152 0.91
153 0.92
154 0.92
155 0.91
156 0.88
157 0.83
158 0.75
159 0.69
160 0.59
161 0.49
162 0.38
163 0.3
164 0.21
165 0.16
166 0.13
167 0.11
168 0.11
169 0.09
170 0.08
171 0.06
172 0.05
173 0.06
174 0.06
175 0.07
176 0.07
177 0.09
178 0.1
179 0.09
180 0.1
181 0.09
182 0.09
183 0.09
184 0.09
185 0.07
186 0.07
187 0.08
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.06
194 0.05
195 0.04
196 0.04
197 0.04
198 0.04
199 0.03
200 0.04
201 0.04
202 0.04
203 0.04
204 0.04
205 0.05
206 0.11
207 0.11
208 0.12
209 0.13
210 0.16
211 0.16
212 0.25
213 0.28
214 0.29
215 0.3
216 0.36
217 0.37
218 0.36
219 0.37
220 0.3
221 0.27
222 0.22
223 0.21
224 0.17
225 0.16
226 0.15
227 0.13
228 0.12
229 0.11
230 0.12
231 0.12
232 0.09
233 0.07
234 0.07
235 0.07
236 0.07
237 0.07
238 0.04
239 0.04
240 0.04
241 0.05
242 0.05
243 0.05
244 0.05
245 0.07
246 0.17
247 0.18
248 0.2
249 0.28
250 0.32
251 0.33
252 0.33
253 0.31
254 0.22
255 0.23
256 0.26
257 0.23
258 0.23
259 0.23
260 0.23
261 0.23
262 0.22
263 0.22
264 0.16
265 0.15
266 0.17
267 0.19
268 0.2
269 0.21
270 0.24
271 0.26
272 0.26
273 0.25
274 0.23
275 0.2
276 0.18
277 0.17
278 0.16
279 0.13
280 0.12
281 0.11
282 0.08
283 0.09
284 0.12
285 0.12
286 0.12
287 0.14
288 0.14
289 0.13
290 0.14
291 0.14
292 0.13
293 0.12
294 0.12
295 0.09
296 0.08
297 0.08
298 0.07
299 0.06
300 0.04
301 0.04
302 0.04
303 0.04
304 0.05
305 0.06
306 0.07
307 0.1
308 0.13
309 0.14
310 0.16
311 0.18
312 0.22
313 0.24
314 0.25
315 0.24
316 0.23
317 0.23
318 0.22
319 0.21
320 0.2
321 0.19
322 0.15
323 0.13
324 0.12
325 0.12
326 0.11
327 0.11
328 0.09
329 0.09
330 0.14
331 0.21
332 0.27
333 0.32
334 0.42
335 0.5
336 0.59
337 0.62
338 0.66
339 0.64
340 0.66
341 0.71
342 0.69
343 0.67
344 0.63
345 0.6
346 0.55
347 0.49
348 0.42
349 0.33
350 0.26
351 0.2
352 0.18
353 0.17