Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GS34

Protein Details
Accession A0A1Y2GS34   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-23RPDPHKQAASRRYQNKIKSRGGHydrophilic
NLS Segment(s)
PositionSequence
41-57GRREGGGHGRGQGRGGG
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026187  Aven  
Amino Acid Sequences MRPDPHKQAASRRYQNKIKSRGGAVAGTKADSTATSGGDRGRREGGGHGRGQGRGGGRGGYRNGTRDEESEDEDNVNEAPRKSYARRKIVSNADRYVELDEEVNEAEELEQGIDRQTIAFREMLKDPDQKKTFDPTAYFRFKSEKEVDSQDQMEEPQQVRKLLEVRLNDIEQALMTLSIKERLYLQDASAESVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.8
4 0.8
5 0.77
6 0.73
7 0.68
8 0.64
9 0.59
10 0.53
11 0.45
12 0.41
13 0.34
14 0.29
15 0.26
16 0.21
17 0.18
18 0.14
19 0.15
20 0.1
21 0.11
22 0.11
23 0.12
24 0.16
25 0.2
26 0.21
27 0.21
28 0.22
29 0.21
30 0.22
31 0.27
32 0.32
33 0.32
34 0.33
35 0.35
36 0.34
37 0.34
38 0.34
39 0.3
40 0.23
41 0.2
42 0.19
43 0.17
44 0.15
45 0.19
46 0.2
47 0.21
48 0.21
49 0.21
50 0.23
51 0.24
52 0.25
53 0.22
54 0.26
55 0.23
56 0.25
57 0.23
58 0.21
59 0.18
60 0.16
61 0.16
62 0.11
63 0.11
64 0.1
65 0.09
66 0.1
67 0.12
68 0.15
69 0.19
70 0.29
71 0.37
72 0.43
73 0.45
74 0.48
75 0.53
76 0.59
77 0.6
78 0.56
79 0.49
80 0.41
81 0.39
82 0.36
83 0.3
84 0.2
85 0.14
86 0.09
87 0.08
88 0.07
89 0.07
90 0.06
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.07
106 0.09
107 0.09
108 0.11
109 0.13
110 0.16
111 0.19
112 0.26
113 0.26
114 0.35
115 0.37
116 0.36
117 0.36
118 0.4
119 0.4
120 0.36
121 0.37
122 0.33
123 0.39
124 0.44
125 0.42
126 0.36
127 0.38
128 0.36
129 0.41
130 0.4
131 0.34
132 0.32
133 0.38
134 0.39
135 0.38
136 0.38
137 0.31
138 0.26
139 0.25
140 0.23
141 0.21
142 0.19
143 0.21
144 0.23
145 0.24
146 0.24
147 0.27
148 0.28
149 0.28
150 0.33
151 0.29
152 0.32
153 0.35
154 0.36
155 0.32
156 0.29
157 0.24
158 0.18
159 0.16
160 0.11
161 0.07
162 0.07
163 0.08
164 0.09
165 0.14
166 0.14
167 0.14
168 0.16
169 0.18
170 0.23
171 0.23
172 0.22
173 0.23
174 0.24