Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9NWD1

Protein Details
Accession G9NWD1    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-32NLPDTWGRPWRMRRRKQQDLVFCHNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 13, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
Pfam View protein in Pfam  
PF01636  APH  
Amino Acid Sequences MHSRSRNLPDTWGRPWRMRRRKQQDLVFCHNNLSMNNVIVDLGTLKIKAIVDWEYAGFYPPEFEFPFYQRPGSSVALDGEVDDFDLLTRMISDDEDCGTRSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.66
3 0.69
4 0.72
5 0.76
6 0.8
7 0.81
8 0.88
9 0.9
10 0.89
11 0.87
12 0.85
13 0.83
14 0.77
15 0.67
16 0.57
17 0.49
18 0.42
19 0.32
20 0.27
21 0.19
22 0.14
23 0.14
24 0.12
25 0.11
26 0.09
27 0.09
28 0.05
29 0.05
30 0.05
31 0.05
32 0.04
33 0.06
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.09
40 0.09
41 0.08
42 0.08
43 0.09
44 0.07
45 0.06
46 0.07
47 0.06
48 0.09
49 0.09
50 0.12
51 0.13
52 0.16
53 0.22
54 0.21
55 0.23
56 0.19
57 0.2
58 0.22
59 0.22
60 0.2
61 0.16
62 0.16
63 0.16
64 0.15
65 0.14
66 0.11
67 0.08
68 0.08
69 0.06
70 0.05
71 0.04
72 0.05
73 0.05
74 0.04
75 0.05
76 0.05
77 0.06
78 0.07
79 0.08
80 0.09
81 0.11
82 0.12