Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GT61

Protein Details
Accession A0A1Y2GT61    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
52-71DVNRKKHFEKAKARRMRYEEBasic
NLS Segment(s)
PositionSequence
60-65EKAKAR
Subcellular Location(s) nucl 17, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSKLDLHKHVSCEDLILQLDRCHHENVLNRYLGRCNSLKQAMNECLQAEFDVNRKKHFEKAKARRMRYEEAWKDMDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.17
4 0.16
5 0.16
6 0.15
7 0.18
8 0.19
9 0.2
10 0.19
11 0.18
12 0.21
13 0.28
14 0.33
15 0.35
16 0.33
17 0.31
18 0.31
19 0.33
20 0.29
21 0.26
22 0.2
23 0.17
24 0.2
25 0.24
26 0.26
27 0.25
28 0.3
29 0.29
30 0.29
31 0.28
32 0.24
33 0.2
34 0.17
35 0.15
36 0.11
37 0.09
38 0.14
39 0.21
40 0.22
41 0.24
42 0.29
43 0.31
44 0.37
45 0.46
46 0.5
47 0.53
48 0.63
49 0.71
50 0.77
51 0.8
52 0.81
53 0.78
54 0.76
55 0.73
56 0.73
57 0.69
58 0.65