Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GBS1

Protein Details
Accession A0A1Y2GBS1    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-61QTTTARSKSKPRRTVNDGYIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR019404  Mediator_Med11  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10280  Med11  
Amino Acid Sequences MEDTNMASPPGSSHPSSSLASDATEYSDSQSQSQSQSQSRSQTTTARSKSKPRRTVNDGYIYQAYDDYTRRKKNQDDTDGVDSILKEDNNQTSATRILELRGLERRIVQLLETAGQAIQILSGDDDEEEENEEVGKRLLAATSLSPEARKAMVQEYADERAKKFETLATGYATLVDEIQSGLRRQFHYLTKAGISSSQVPFKNVVYGEEKELDTWLNAADLLKQSTNELIAKINRELLSSVNEQQNSTSADSAVVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.28
4 0.27
5 0.23
6 0.2
7 0.19
8 0.18
9 0.15
10 0.14
11 0.14
12 0.13
13 0.15
14 0.18
15 0.18
16 0.19
17 0.21
18 0.2
19 0.23
20 0.27
21 0.3
22 0.3
23 0.35
24 0.38
25 0.43
26 0.43
27 0.42
28 0.41
29 0.41
30 0.43
31 0.48
32 0.5
33 0.51
34 0.53
35 0.61
36 0.69
37 0.74
38 0.77
39 0.76
40 0.78
41 0.78
42 0.83
43 0.79
44 0.78
45 0.67
46 0.61
47 0.54
48 0.45
49 0.37
50 0.28
51 0.22
52 0.15
53 0.17
54 0.21
55 0.28
56 0.35
57 0.4
58 0.46
59 0.52
60 0.6
61 0.67
62 0.67
63 0.64
64 0.62
65 0.63
66 0.56
67 0.49
68 0.4
69 0.3
70 0.23
71 0.2
72 0.14
73 0.1
74 0.12
75 0.14
76 0.14
77 0.15
78 0.13
79 0.12
80 0.14
81 0.14
82 0.12
83 0.11
84 0.1
85 0.12
86 0.12
87 0.14
88 0.17
89 0.18
90 0.17
91 0.18
92 0.18
93 0.17
94 0.17
95 0.14
96 0.1
97 0.1
98 0.1
99 0.09
100 0.08
101 0.07
102 0.07
103 0.06
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.04
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.06
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.05
128 0.05
129 0.07
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.09
138 0.1
139 0.14
140 0.14
141 0.15
142 0.17
143 0.21
144 0.24
145 0.23
146 0.22
147 0.22
148 0.22
149 0.21
150 0.18
151 0.16
152 0.16
153 0.18
154 0.19
155 0.17
156 0.17
157 0.16
158 0.16
159 0.14
160 0.11
161 0.08
162 0.07
163 0.05
164 0.05
165 0.07
166 0.08
167 0.09
168 0.11
169 0.15
170 0.16
171 0.19
172 0.24
173 0.27
174 0.31
175 0.32
176 0.32
177 0.29
178 0.28
179 0.26
180 0.22
181 0.2
182 0.2
183 0.21
184 0.26
185 0.25
186 0.26
187 0.27
188 0.26
189 0.28
190 0.23
191 0.23
192 0.22
193 0.23
194 0.25
195 0.26
196 0.26
197 0.21
198 0.22
199 0.19
200 0.14
201 0.13
202 0.1
203 0.07
204 0.07
205 0.07
206 0.1
207 0.11
208 0.14
209 0.15
210 0.15
211 0.16
212 0.16
213 0.19
214 0.17
215 0.16
216 0.19
217 0.21
218 0.25
219 0.25
220 0.3
221 0.27
222 0.27
223 0.27
224 0.24
225 0.26
226 0.26
227 0.31
228 0.31
229 0.32
230 0.31
231 0.31
232 0.33
233 0.31
234 0.29
235 0.24
236 0.18