Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GHF7

Protein Details
Accession A0A1Y2GHF7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-69ESDIVKEHKPRRERRERSRRDRTSRQSQQQQQNDHydrophilic
NLS Segment(s)
PositionSequence
43-57HKPRRERRERSRRDR
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
Amino Acid Sequences MLISLHHLHNTYTIHLNKTSISNILRILAWTVTTIESDIVKEHKPRRERRERSRRDRTSRQSQQQQQNDLNKDEMSNTNNNSNDGSMKQQQQTTHRVIVDPNSFQRQILQPNPNSSGGNDRKVAMAGGASTRSVGELYDDDSRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.3
4 0.28
5 0.29
6 0.27
7 0.24
8 0.23
9 0.21
10 0.21
11 0.21
12 0.2
13 0.17
14 0.17
15 0.12
16 0.11
17 0.1
18 0.1
19 0.09
20 0.09
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.11
27 0.13
28 0.2
29 0.26
30 0.33
31 0.42
32 0.51
33 0.6
34 0.69
35 0.76
36 0.81
37 0.86
38 0.89
39 0.91
40 0.92
41 0.92
42 0.89
43 0.9
44 0.87
45 0.87
46 0.85
47 0.84
48 0.82
49 0.81
50 0.81
51 0.76
52 0.73
53 0.68
54 0.65
55 0.59
56 0.5
57 0.43
58 0.33
59 0.27
60 0.23
61 0.2
62 0.16
63 0.16
64 0.16
65 0.2
66 0.2
67 0.21
68 0.19
69 0.18
70 0.16
71 0.14
72 0.17
73 0.17
74 0.21
75 0.23
76 0.25
77 0.28
78 0.32
79 0.37
80 0.37
81 0.36
82 0.32
83 0.3
84 0.29
85 0.31
86 0.3
87 0.28
88 0.27
89 0.28
90 0.28
91 0.27
92 0.3
93 0.28
94 0.31
95 0.36
96 0.4
97 0.39
98 0.43
99 0.47
100 0.46
101 0.42
102 0.36
103 0.38
104 0.35
105 0.36
106 0.33
107 0.3
108 0.28
109 0.28
110 0.27
111 0.17
112 0.13
113 0.1
114 0.11
115 0.11
116 0.1
117 0.1
118 0.1
119 0.1
120 0.1
121 0.08
122 0.09
123 0.09
124 0.13