Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GJC1

Protein Details
Accession A0A1Y2GJC1    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
62-89VSTLMRKWDKSRKQCKEFKKIREIKESEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, mito_nucl 13.333, cyto_mito 11.333, nucl 4.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIIIKIRHISIFHIVCSSIAFFFFFFYLFLGKIKGRQPSLYPLLSIYLFFSFFFFFFLFCSVSTLMRKWDKSRKQCKEFKKIREIKESERAKGANGICFACLKQMGSKASTCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.22
4 0.19
5 0.11
6 0.1
7 0.09
8 0.08
9 0.09
10 0.09
11 0.08
12 0.07
13 0.07
14 0.08
15 0.08
16 0.09
17 0.1
18 0.1
19 0.15
20 0.19
21 0.24
22 0.24
23 0.26
24 0.28
25 0.32
26 0.37
27 0.32
28 0.28
29 0.23
30 0.23
31 0.21
32 0.19
33 0.13
34 0.09
35 0.08
36 0.08
37 0.09
38 0.08
39 0.07
40 0.09
41 0.07
42 0.07
43 0.07
44 0.08
45 0.08
46 0.07
47 0.09
48 0.08
49 0.1
50 0.11
51 0.12
52 0.16
53 0.2
54 0.22
55 0.26
56 0.36
57 0.44
58 0.54
59 0.64
60 0.69
61 0.74
62 0.81
63 0.84
64 0.85
65 0.85
66 0.83
67 0.83
68 0.81
69 0.79
70 0.81
71 0.76
72 0.72
73 0.73
74 0.68
75 0.59
76 0.56
77 0.5
78 0.4
79 0.42
80 0.37
81 0.32
82 0.3
83 0.28
84 0.24
85 0.25
86 0.24
87 0.2
88 0.19
89 0.16
90 0.18
91 0.23
92 0.25
93 0.27