Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GWB8

Protein Details
Accession A0A1Y2GWB8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-47DASTLNKRKRENQHPQRKKRAIPLLLHydrophilic
NLS Segment(s)
PositionSequence
28-41KRKRENQHPQRKKR
Subcellular Location(s) nucl 17.5, cyto_nucl 13.833, mito_nucl 10.166, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MAANDSTESQAQKNMAANKPEDASTLNKRKRENQHPQRKKRAIPLLLQLNCVVEGEATSFPVEIFCDKSVGELKQAIKVAKKPELDHVAADKLTLYKVSIPDEDKTVVESEIVSKETLVSASMELWEIFTSELPRKTIHVFVKPPQRGMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.37
4 0.37
5 0.36
6 0.37
7 0.34
8 0.3
9 0.24
10 0.25
11 0.31
12 0.4
13 0.43
14 0.46
15 0.5
16 0.58
17 0.66
18 0.71
19 0.73
20 0.73
21 0.79
22 0.85
23 0.92
24 0.93
25 0.91
26 0.85
27 0.83
28 0.82
29 0.75
30 0.68
31 0.66
32 0.64
33 0.57
34 0.53
35 0.44
36 0.34
37 0.3
38 0.25
39 0.17
40 0.07
41 0.06
42 0.07
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.07
49 0.07
50 0.05
51 0.08
52 0.07
53 0.08
54 0.08
55 0.1
56 0.12
57 0.12
58 0.13
59 0.14
60 0.14
61 0.17
62 0.19
63 0.19
64 0.18
65 0.22
66 0.24
67 0.26
68 0.28
69 0.25
70 0.3
71 0.34
72 0.32
73 0.3
74 0.28
75 0.24
76 0.21
77 0.2
78 0.14
79 0.1
80 0.09
81 0.08
82 0.07
83 0.08
84 0.1
85 0.12
86 0.15
87 0.16
88 0.17
89 0.19
90 0.2
91 0.18
92 0.18
93 0.16
94 0.13
95 0.11
96 0.1
97 0.1
98 0.11
99 0.12
100 0.1
101 0.09
102 0.09
103 0.1
104 0.1
105 0.08
106 0.07
107 0.07
108 0.07
109 0.08
110 0.08
111 0.08
112 0.08
113 0.08
114 0.07
115 0.07
116 0.08
117 0.12
118 0.17
119 0.2
120 0.21
121 0.22
122 0.24
123 0.27
124 0.34
125 0.37
126 0.4
127 0.43
128 0.5
129 0.6
130 0.6