Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GHG4

Protein Details
Accession A0A1Y2GHG4    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
52-71EDLAERKKRGQGRRSTLKKKBasic
NLS Segment(s)
PositionSequence
57-71RKKRGQGRRSTLKKK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences ATNKLALLNKISCAIFGNILRQRLIGPTINSYYPNDGPEMNLIDQTEKTRLEDLAERKKRGQGRRSTLKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.25
5 0.25
6 0.26
7 0.26
8 0.24
9 0.23
10 0.21
11 0.23
12 0.18
13 0.16
14 0.18
15 0.19
16 0.2
17 0.21
18 0.2
19 0.2
20 0.18
21 0.17
22 0.15
23 0.13
24 0.12
25 0.13
26 0.14
27 0.11
28 0.11
29 0.1
30 0.11
31 0.11
32 0.13
33 0.14
34 0.12
35 0.13
36 0.14
37 0.14
38 0.16
39 0.22
40 0.28
41 0.37
42 0.44
43 0.46
44 0.47
45 0.54
46 0.59
47 0.62
48 0.64
49 0.64
50 0.66
51 0.74