Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GCP1

Protein Details
Accession A0A1Y2GCP1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
39-63EKTPPSYLRLNKRRKRRLAVDEAVEHydrophilic
NLS Segment(s)
PositionSequence
50-54KRRKR
Subcellular Location(s) plas 8, extr 7, mito 6, E.R. 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIVTSIVLSAVSSAALMMSILTAGPFLPKHMDSLDGLAEKTPPSYLRLNKRRKRRLAVDEAVEMEKYYRGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.05
12 0.05
13 0.06
14 0.08
15 0.09
16 0.1
17 0.11
18 0.12
19 0.11
20 0.12
21 0.13
22 0.1
23 0.1
24 0.09
25 0.09
26 0.08
27 0.08
28 0.07
29 0.07
30 0.1
31 0.16
32 0.23
33 0.33
34 0.44
35 0.55
36 0.61
37 0.72
38 0.79
39 0.82
40 0.84
41 0.83
42 0.83
43 0.82
44 0.82
45 0.75
46 0.67
47 0.6
48 0.52
49 0.42
50 0.32
51 0.23
52 0.18