Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2H1X3

Protein Details
Accession A0A1Y2H1X3   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
56-76EEPMQVEKSKKNKRKKAYSLIHydrophilic
NLS Segment(s)
PositionSequence
10-14ARKFR
63-71KSKKNKRKK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSKSARKFRAIKRETVFGPVETARVHRLAERLKKDAQGPKTSELEAIARGEEPMQVEKSKKNKRKKAYSLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.74
3 0.72
4 0.65
5 0.66
6 0.58
7 0.54
8 0.46
9 0.35
10 0.35
11 0.26
12 0.23
13 0.18
14 0.18
15 0.14
16 0.14
17 0.14
18 0.12
19 0.16
20 0.22
21 0.29
22 0.32
23 0.34
24 0.34
25 0.36
26 0.4
27 0.42
28 0.4
29 0.39
30 0.38
31 0.38
32 0.38
33 0.36
34 0.31
35 0.26
36 0.22
37 0.17
38 0.14
39 0.11
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.12
46 0.14
47 0.16
48 0.19
49 0.26
50 0.36
51 0.47
52 0.54
53 0.62
54 0.7
55 0.78
56 0.87