Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GZH2

Protein Details
Accession A0A1Y2GZH2   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAKSKNHTNHNQNKKAHRNGIKKPKTQRHPSLKHydrophilic
NLS Segment(s)
PositionSequence
14-56KKAHRNGIKKPKTQRHPSLKGVDPKFLRNQRFAKRGSAAALRK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKTQRHPSLKGVDPKFLRNQRFAKRGSAAALRKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.81
4 0.81
5 0.79
6 0.8
7 0.84
8 0.82
9 0.8
10 0.82
11 0.82
12 0.81
13 0.81
14 0.81
15 0.8
16 0.78
17 0.77
18 0.73
19 0.7
20 0.69
21 0.62
22 0.59
23 0.5
24 0.47
25 0.51
26 0.52
27 0.49
28 0.48
29 0.55
30 0.57
31 0.62
32 0.61
33 0.58
34 0.54
35 0.53
36 0.5
37 0.51