Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GYF4

Protein Details
Accession A0A1Y2GYF4    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-30VPKTRNTYCKGKTCKKHTAHKVSQYKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRNTYCKGKTCKKHTAHKVSQYKTGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECQVCKYKHQIALKRCKHFELGGDKKQKGQALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.78
4 0.83
5 0.81
6 0.84
7 0.85
8 0.85
9 0.84
10 0.84
11 0.85
12 0.78
13 0.8
14 0.74
15 0.66
16 0.58
17 0.54
18 0.44
19 0.36
20 0.36
21 0.34
22 0.36
23 0.36
24 0.41
25 0.43
26 0.47
27 0.51
28 0.55
29 0.53
30 0.56
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.61
58 0.61
59 0.62
60 0.56
61 0.5
62 0.5
63 0.44
64 0.43
65 0.45
66 0.44
67 0.44
68 0.51
69 0.56
70 0.58
71 0.68
72 0.72
73 0.75
74 0.7
75 0.66
76 0.61
77 0.54
78 0.52
79 0.51
80 0.52
81 0.52
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57