Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GW56

Protein Details
Accession A0A1Y2GW56    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-43KVKSQTPKVAKQEKKKKLTGRAKKRETYKRRFBasic
NLS Segment(s)
PositionSequence
10-42AGKVKSQTPKVAKQEKKKKLTGRAKKRETYKRR
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences GKVHGSLARAGKVKSQTPKVAKQEKKKKLTGRAKKRETYKRRFVNITNAPGGKRRVSEEIVKFHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.49
4 0.53
5 0.61
6 0.65
7 0.7
8 0.71
9 0.74
10 0.78
11 0.8
12 0.8
13 0.79
14 0.77
15 0.77
16 0.8
17 0.8
18 0.81
19 0.81
20 0.81
21 0.8
22 0.82
23 0.82
24 0.81
25 0.79
26 0.78
27 0.77
28 0.75
29 0.74
30 0.67
31 0.67
32 0.64
33 0.6
34 0.55
35 0.48
36 0.44
37 0.44
38 0.45
39 0.37
40 0.32
41 0.31
42 0.31
43 0.34
44 0.42
45 0.43