Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GP43

Protein Details
Accession A0A1Y2GP43   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGSLFSKQSKTQKPKDPKWQGIGPNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000095  CRIB_dom  
PROSITE View protein in PROSITE  
PS50108  CRIB  
Amino Acid Sequences MGSLFSKQSKTQKPKDPKWQGIGPNTPLPNSPSSNQDNQSRSHTLATLDSRMNNNNTRPTKPAPAKGKSSKIMLLLKMDPKSGGQRKVISKNLISLPSDFRHTGHIGAGEVRSGQIDVSTIKAKSSHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.88
4 0.85
5 0.83
6 0.81
7 0.78
8 0.75
9 0.72
10 0.65
11 0.61
12 0.54
13 0.47
14 0.41
15 0.37
16 0.33
17 0.3
18 0.26
19 0.26
20 0.3
21 0.35
22 0.37
23 0.41
24 0.39
25 0.38
26 0.43
27 0.39
28 0.35
29 0.31
30 0.28
31 0.22
32 0.24
33 0.23
34 0.21
35 0.19
36 0.19
37 0.2
38 0.22
39 0.24
40 0.24
41 0.24
42 0.3
43 0.32
44 0.33
45 0.35
46 0.36
47 0.41
48 0.42
49 0.47
50 0.46
51 0.47
52 0.52
53 0.53
54 0.56
55 0.49
56 0.47
57 0.41
58 0.38
59 0.37
60 0.3
61 0.28
62 0.25
63 0.28
64 0.26
65 0.25
66 0.2
67 0.19
68 0.27
69 0.3
70 0.31
71 0.3
72 0.35
73 0.42
74 0.49
75 0.53
76 0.48
77 0.43
78 0.44
79 0.44
80 0.4
81 0.35
82 0.3
83 0.29
84 0.27
85 0.3
86 0.25
87 0.22
88 0.24
89 0.24
90 0.23
91 0.2
92 0.19
93 0.16
94 0.17
95 0.17
96 0.13
97 0.12
98 0.11
99 0.1
100 0.09
101 0.08
102 0.06
103 0.07
104 0.08
105 0.11
106 0.15
107 0.15
108 0.16
109 0.18