Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GFB8

Protein Details
Accession A0A1Y2GFB8    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-119LDLRVKKTRAIRRRLTKHEASRKTVKQQKKDTHFPLRKYHydrophilic
NLS Segment(s)
PositionSequence
85-110VKKTRAIRRRLTKHEASRKTVKQQKK
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MAAVKAHELRTKNKAELTKQLEELKQELAALKVQKVAGGSSSKLTRISAVRKSIARVLTVITQTQRAQLRIFYQKKNFLPLDLRVKKTRAIRRRLTKHEASRKTVKQQKKDTHFPLRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.56
4 0.57
5 0.54
6 0.52
7 0.54
8 0.5
9 0.45
10 0.42
11 0.33
12 0.26
13 0.22
14 0.18
15 0.14
16 0.16
17 0.15
18 0.14
19 0.16
20 0.15
21 0.16
22 0.15
23 0.14
24 0.13
25 0.14
26 0.14
27 0.14
28 0.15
29 0.16
30 0.16
31 0.16
32 0.16
33 0.18
34 0.23
35 0.26
36 0.28
37 0.31
38 0.31
39 0.32
40 0.34
41 0.31
42 0.25
43 0.2
44 0.18
45 0.17
46 0.17
47 0.16
48 0.12
49 0.13
50 0.13
51 0.17
52 0.18
53 0.16
54 0.16
55 0.17
56 0.21
57 0.29
58 0.34
59 0.35
60 0.38
61 0.45
62 0.45
63 0.51
64 0.46
65 0.38
66 0.37
67 0.38
68 0.44
69 0.42
70 0.45
71 0.42
72 0.43
73 0.46
74 0.51
75 0.55
76 0.53
77 0.57
78 0.63
79 0.7
80 0.78
81 0.82
82 0.81
83 0.81
84 0.82
85 0.84
86 0.81
87 0.77
88 0.77
89 0.75
90 0.77
91 0.77
92 0.75
93 0.75
94 0.78
95 0.82
96 0.81
97 0.84
98 0.83
99 0.85
100 0.84
101 0.78
102 0.78
103 0.76