Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GEJ0

Protein Details
Accession A0A1Y2GEJ0   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-33EDASTLNKRKRENQHPQRKKRAIPLLLHydrophilic
NLS Segment(s)
PositionSequence
14-27KRKRENQHPQRKKR
Subcellular Location(s) nucl 16.5, mito_nucl 11, cyto 6, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045379  Crinkler_N  
Gene Ontology GO:0005576  C:extracellular region  
Pfam View protein in Pfam  
PF20147  Crinkler  
Amino Acid Sequences MAANKPEDASTLNKRKRENQHPQRKKRAIPLLLQLNCIVEGEATSFPVEIFCDKSVGMLKQAIKVAKKPELDHAAADKLTLYKVSIPDEDKTVVESEIVSKETLVPASMELWEIFNSELPRKTIHVFVKPPQRGMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.69
4 0.74
5 0.75
6 0.76
7 0.81
8 0.87
9 0.92
10 0.94
11 0.92
12 0.86
13 0.85
14 0.84
15 0.77
16 0.71
17 0.69
18 0.68
19 0.61
20 0.56
21 0.46
22 0.37
23 0.32
24 0.27
25 0.18
26 0.08
27 0.07
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.08
36 0.06
37 0.09
38 0.08
39 0.09
40 0.09
41 0.1
42 0.12
43 0.12
44 0.13
45 0.14
46 0.14
47 0.17
48 0.19
49 0.21
50 0.19
51 0.22
52 0.24
53 0.26
54 0.27
55 0.26
56 0.29
57 0.31
58 0.31
59 0.28
60 0.26
61 0.22
62 0.2
63 0.19
64 0.13
65 0.09
66 0.08
67 0.08
68 0.06
69 0.07
70 0.09
71 0.11
72 0.14
73 0.16
74 0.16
75 0.18
76 0.19
77 0.17
78 0.17
79 0.15
80 0.13
81 0.11
82 0.1
83 0.1
84 0.1
85 0.11
86 0.1
87 0.09
88 0.1
89 0.1
90 0.11
91 0.09
92 0.08
93 0.07
94 0.08
95 0.09
96 0.09
97 0.08
98 0.09
99 0.09
100 0.09
101 0.09
102 0.12
103 0.14
104 0.17
105 0.2
106 0.21
107 0.23
108 0.25
109 0.27
110 0.32
111 0.36
112 0.4
113 0.43
114 0.5
115 0.58
116 0.59