Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GGF0

Protein Details
Accession A0A1Y2GGF0   
Localization Confidence Low
Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-54TRNTYCKGKTCKKHTAHKVSQYKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MNIKNLYIANFCKAWTLQPLKDTCKVNVPKTRNTYCKGKTCKKHTAHKVSQYKTGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECQVCKYKHQIALKRCKHFELGGDKKQKGQALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.32
4 0.31
5 0.37
6 0.42
7 0.43
8 0.5
9 0.5
10 0.42
11 0.46
12 0.49
13 0.51
14 0.55
15 0.55
16 0.57
17 0.62
18 0.69
19 0.65
20 0.64
21 0.65
22 0.63
23 0.67
24 0.68
25 0.69
26 0.71
27 0.73
28 0.78
29 0.76
30 0.8
31 0.81
32 0.82
33 0.8
34 0.81
35 0.81
36 0.73
37 0.76
38 0.69
39 0.61
40 0.52
41 0.49
42 0.39
43 0.31
44 0.31
45 0.29
46 0.31
47 0.31
48 0.36
49 0.38
50 0.41
51 0.45
52 0.49
53 0.46
54 0.5
55 0.56
56 0.54
57 0.56
58 0.55
59 0.55
60 0.55
61 0.58
62 0.49
63 0.45
64 0.42
65 0.35
66 0.38
67 0.4
68 0.38
69 0.34
70 0.41
71 0.45
72 0.53
73 0.62
74 0.65
75 0.64
76 0.68
77 0.74
78 0.75
79 0.73
80 0.7
81 0.64
82 0.64
83 0.65
84 0.59
85 0.53
86 0.53
87 0.47
88 0.45
89 0.48
90 0.46
91 0.46
92 0.53
93 0.58
94 0.6
95 0.7
96 0.73
97 0.76
98 0.71
99 0.67
100 0.62
101 0.55
102 0.53
103 0.53
104 0.53
105 0.53
106 0.6
107 0.58
108 0.59
109 0.62
110 0.58