Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GF87

Protein Details
Accession A0A1Y2GF87   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76HPLMRPRHSKIRPHNPTEHVBasic
NLS Segment(s)
Subcellular Location(s) plas 19, E.R. 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008389  ATPase_V0-cplx_e1/e2_su  
Gene Ontology GO:0033179  C:proton-transporting V-type ATPase, V0 domain  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF05493  ATP_synt_H  
Amino Acid Sequences MGGLLIVFVFAVVVALSSASYLFTPRGPNQTVIRTALIMTLVSCFLMWSITYLAQLHPLMRPRHSKIRPHNPTEHVTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.08
11 0.13
12 0.15
13 0.21
14 0.22
15 0.26
16 0.28
17 0.31
18 0.31
19 0.29
20 0.27
21 0.21
22 0.19
23 0.16
24 0.13
25 0.09
26 0.07
27 0.05
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.08
39 0.08
40 0.08
41 0.12
42 0.12
43 0.12
44 0.14
45 0.21
46 0.23
47 0.27
48 0.35
49 0.38
50 0.49
51 0.55
52 0.62
53 0.66
54 0.75
55 0.79
56 0.79
57 0.81
58 0.76