Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GZZ0

Protein Details
Accession A0A1Y2GZZ0    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MGRLRRSRVHKGIRDIQRKYRTKRYMRDIDQIHBasic
NLS Segment(s)
PositionSequence
81-86KIHKKR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
Amino Acid Sequences MGRLRRSRVHKGIRDIQRKYRTKRYMRDIDQIHGDIQPENAEKFQKPELDPDLPGMGQFYCIPCAKHHINKESLLEHQKGKIHKKRLKLLKEEPYSQAEADAAAGLQRADTKVKKPKNTTTTTTTATGEAMDVTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.8
4 0.8
5 0.81
6 0.8
7 0.81
8 0.8
9 0.8
10 0.83
11 0.83
12 0.83
13 0.8
14 0.81
15 0.73
16 0.66
17 0.61
18 0.53
19 0.43
20 0.34
21 0.29
22 0.2
23 0.17
24 0.17
25 0.13
26 0.13
27 0.14
28 0.15
29 0.15
30 0.17
31 0.2
32 0.22
33 0.21
34 0.25
35 0.29
36 0.29
37 0.28
38 0.27
39 0.25
40 0.2
41 0.19
42 0.15
43 0.09
44 0.08
45 0.08
46 0.07
47 0.09
48 0.1
49 0.11
50 0.11
51 0.17
52 0.2
53 0.26
54 0.3
55 0.32
56 0.34
57 0.35
58 0.37
59 0.32
60 0.32
61 0.3
62 0.27
63 0.24
64 0.24
65 0.26
66 0.29
67 0.38
68 0.41
69 0.48
70 0.5
71 0.58
72 0.64
73 0.7
74 0.72
75 0.71
76 0.72
77 0.72
78 0.73
79 0.68
80 0.61
81 0.56
82 0.49
83 0.4
84 0.32
85 0.21
86 0.16
87 0.13
88 0.1
89 0.06
90 0.04
91 0.05
92 0.04
93 0.05
94 0.06
95 0.07
96 0.12
97 0.16
98 0.24
99 0.34
100 0.42
101 0.51
102 0.58
103 0.67
104 0.71
105 0.75
106 0.72
107 0.69
108 0.67
109 0.61
110 0.56
111 0.47
112 0.38
113 0.32
114 0.26
115 0.19
116 0.14