Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NI77

Protein Details
Accession G9NI77    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
244-277NEPSRHDSKSSKSKKKKKGSKRKSDKNDPGSPTSBasic
NLS Segment(s)
PositionSequence
252-268KSSKSKKKKKGSKRKSD
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039773  BAG_chaperone_regulator  
IPR036533  BAG_dom_sf  
IPR003103  BAG_domain  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF02179  BAG  
PROSITE View protein in PROSITE  
PS51035  BAG  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MYCKGVLRQGHLDIQDAKVDSSEPVVASSGALQHLIANYLNGTLTNLSAAFQESSEYISGTLGVPPTYVYSGLAALVALPITMSRFGWSLNREQSFGAMPGGVPDITNEDFSYIPAQDLDDPRVEYIDTRHFPRPPSRGPSDLEDDILVIKHKGITYPAHFPAYSIGDGKLYVKDVRDRVGLMMELSSRTTRRIKLLYKGKQLKESSLPIRQYGVKNKSELMAVIPDGDDENSDRSDEDVITVNEPSRHDSKSSKSKKKKKGSKRKSDKNDPGSPTSPLDSGSNGDAANGAVINAASKKLDEIEDEFRSKWLPLCLDYIDAPPKDAKKREDEHRKISETVLQQVILKLDGVETEGIDEIRQRRKELVRRTQEVLKQLDTAKAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.29
4 0.26
5 0.2
6 0.2
7 0.16
8 0.16
9 0.16
10 0.12
11 0.12
12 0.13
13 0.12
14 0.12
15 0.12
16 0.12
17 0.11
18 0.11
19 0.1
20 0.11
21 0.11
22 0.13
23 0.11
24 0.1
25 0.09
26 0.1
27 0.1
28 0.08
29 0.09
30 0.08
31 0.08
32 0.09
33 0.08
34 0.08
35 0.09
36 0.1
37 0.1
38 0.09
39 0.1
40 0.09
41 0.11
42 0.11
43 0.11
44 0.09
45 0.09
46 0.09
47 0.09
48 0.1
49 0.09
50 0.09
51 0.09
52 0.09
53 0.11
54 0.11
55 0.1
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.06
63 0.06
64 0.05
65 0.04
66 0.03
67 0.03
68 0.05
69 0.06
70 0.06
71 0.07
72 0.07
73 0.09
74 0.14
75 0.16
76 0.22
77 0.29
78 0.3
79 0.3
80 0.3
81 0.31
82 0.27
83 0.26
84 0.19
85 0.11
86 0.1
87 0.1
88 0.11
89 0.09
90 0.07
91 0.07
92 0.1
93 0.11
94 0.12
95 0.11
96 0.11
97 0.11
98 0.12
99 0.14
100 0.1
101 0.09
102 0.09
103 0.1
104 0.12
105 0.14
106 0.16
107 0.15
108 0.16
109 0.16
110 0.16
111 0.15
112 0.12
113 0.13
114 0.2
115 0.2
116 0.24
117 0.29
118 0.31
119 0.34
120 0.42
121 0.45
122 0.43
123 0.48
124 0.48
125 0.47
126 0.47
127 0.47
128 0.45
129 0.39
130 0.33
131 0.25
132 0.21
133 0.18
134 0.16
135 0.12
136 0.06
137 0.06
138 0.07
139 0.07
140 0.08
141 0.1
142 0.13
143 0.16
144 0.22
145 0.23
146 0.24
147 0.23
148 0.23
149 0.23
150 0.22
151 0.19
152 0.14
153 0.12
154 0.11
155 0.11
156 0.12
157 0.1
158 0.1
159 0.1
160 0.1
161 0.15
162 0.15
163 0.17
164 0.17
165 0.17
166 0.15
167 0.15
168 0.14
169 0.09
170 0.09
171 0.07
172 0.07
173 0.07
174 0.08
175 0.08
176 0.11
177 0.14
178 0.15
179 0.19
180 0.24
181 0.27
182 0.35
183 0.44
184 0.49
185 0.56
186 0.62
187 0.6
188 0.62
189 0.6
190 0.54
191 0.48
192 0.46
193 0.4
194 0.38
195 0.37
196 0.3
197 0.31
198 0.32
199 0.32
200 0.36
201 0.38
202 0.34
203 0.34
204 0.34
205 0.33
206 0.29
207 0.25
208 0.17
209 0.12
210 0.09
211 0.09
212 0.08
213 0.07
214 0.07
215 0.07
216 0.06
217 0.06
218 0.07
219 0.07
220 0.07
221 0.07
222 0.08
223 0.09
224 0.08
225 0.09
226 0.1
227 0.11
228 0.11
229 0.12
230 0.12
231 0.14
232 0.14
233 0.17
234 0.17
235 0.17
236 0.19
237 0.22
238 0.29
239 0.38
240 0.48
241 0.55
242 0.63
243 0.73
244 0.81
245 0.88
246 0.91
247 0.92
248 0.93
249 0.93
250 0.94
251 0.94
252 0.95
253 0.94
254 0.95
255 0.94
256 0.91
257 0.89
258 0.82
259 0.77
260 0.68
261 0.6
262 0.51
263 0.42
264 0.33
265 0.25
266 0.21
267 0.16
268 0.15
269 0.14
270 0.13
271 0.11
272 0.11
273 0.1
274 0.09
275 0.08
276 0.06
277 0.05
278 0.04
279 0.04
280 0.05
281 0.05
282 0.06
283 0.06
284 0.06
285 0.07
286 0.09
287 0.1
288 0.11
289 0.15
290 0.21
291 0.25
292 0.28
293 0.27
294 0.26
295 0.27
296 0.25
297 0.24
298 0.22
299 0.2
300 0.2
301 0.23
302 0.23
303 0.24
304 0.24
305 0.26
306 0.28
307 0.25
308 0.25
309 0.27
310 0.32
311 0.38
312 0.43
313 0.44
314 0.47
315 0.54
316 0.63
317 0.7
318 0.72
319 0.74
320 0.76
321 0.75
322 0.67
323 0.62
324 0.58
325 0.5
326 0.48
327 0.4
328 0.32
329 0.29
330 0.29
331 0.28
332 0.21
333 0.18
334 0.12
335 0.1
336 0.1
337 0.1
338 0.09
339 0.08
340 0.08
341 0.09
342 0.09
343 0.09
344 0.14
345 0.19
346 0.28
347 0.31
348 0.32
349 0.39
350 0.49
351 0.59
352 0.65
353 0.69
354 0.7
355 0.73
356 0.76
357 0.77
358 0.72
359 0.7
360 0.64
361 0.55
362 0.49
363 0.46