Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2G979

Protein Details
Accession A0A1Y2G979    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-57VAKQEKKKKLTGRAKKRETYKRRFVNBasic
NLS Segment(s)
PositionSequence
21-54RAGKVKSQTPKVAKQEKKKKLTGRAKKRETYKRR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MVYNDLHYLPFLGKVHGSLARAGKVKSQTPKVAKQEKKKKLTGRAKKRETYKRRFVNITNAPGGKRRMNVNPESSKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.19
4 0.19
5 0.18
6 0.2
7 0.23
8 0.25
9 0.24
10 0.26
11 0.27
12 0.32
13 0.35
14 0.38
15 0.42
16 0.45
17 0.53
18 0.57
19 0.63
20 0.65
21 0.69
22 0.74
23 0.76
24 0.77
25 0.76
26 0.73
27 0.74
28 0.78
29 0.78
30 0.78
31 0.79
32 0.8
33 0.8
34 0.83
35 0.83
36 0.82
37 0.81
38 0.8
39 0.78
40 0.77
41 0.76
42 0.69
43 0.68
44 0.66
45 0.62
46 0.57
47 0.5
48 0.46
49 0.46
50 0.47
51 0.41
52 0.36
53 0.37
54 0.4
55 0.45
56 0.51
57 0.55