Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GHU7

Protein Details
Accession A0A1Y2GHU7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-68LAHPCHSWKYSRKKTNKKKKKNKKEKRQBasic
NLS Segment(s)
PositionSequence
51-68SRKKTNKKKKKNKKEKRQ
Subcellular Location(s) plas 7, mito 6, nucl 5, E.R. 4, extr 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYTSGFSLFVLPLILLVMTKHKKEKKESSMRHFFISQILFLAHPCHSWKYSRKKTNKKKKKNKKEKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.13
5 0.16
6 0.19
7 0.27
8 0.32
9 0.38
10 0.47
11 0.57
12 0.59
13 0.67
14 0.73
15 0.74
16 0.79
17 0.74
18 0.68
19 0.58
20 0.48
21 0.4
22 0.33
23 0.23
24 0.13
25 0.12
26 0.1
27 0.1
28 0.12
29 0.08
30 0.09
31 0.11
32 0.13
33 0.15
34 0.21
35 0.3
36 0.39
37 0.5
38 0.59
39 0.68
40 0.76
41 0.86
42 0.92
43 0.94
44 0.94
45 0.95
46 0.96
47 0.97
48 0.97