Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2G659

Protein Details
Accession A0A1Y2G659   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPTASKPKNKKKNKKSALVTVANLHydrophilic
NLS Segment(s)
PositionSequence
6-15KPKNKKKNKK
Subcellular Location(s) mito 14.5, cyto_mito 11.833, cyto 8, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MPTASKPKNKKKNKKSALVTVANLDKMKKSDLVRRMEHEHPLLVLTTGSLNVNLGCALEGNDAEISAAIEGVRDVVRLAVQIKEKRARAAWPIYRRSYLALFDRETLDCIICPRISHVEHVPPDPPTLIFISTADSESLPASPLAQSVATKLLGDEKRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.9
3 0.9
4 0.88
5 0.82
6 0.72
7 0.66
8 0.59
9 0.51
10 0.44
11 0.35
12 0.28
13 0.24
14 0.24
15 0.24
16 0.26
17 0.31
18 0.38
19 0.45
20 0.46
21 0.5
22 0.53
23 0.51
24 0.52
25 0.45
26 0.38
27 0.31
28 0.27
29 0.22
30 0.16
31 0.13
32 0.08
33 0.06
34 0.07
35 0.06
36 0.06
37 0.06
38 0.05
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.08
67 0.13
68 0.15
69 0.2
70 0.25
71 0.26
72 0.27
73 0.27
74 0.27
75 0.27
76 0.34
77 0.37
78 0.39
79 0.44
80 0.45
81 0.45
82 0.43
83 0.4
84 0.33
85 0.29
86 0.26
87 0.24
88 0.22
89 0.22
90 0.24
91 0.22
92 0.21
93 0.19
94 0.14
95 0.11
96 0.12
97 0.13
98 0.11
99 0.11
100 0.13
101 0.18
102 0.18
103 0.22
104 0.24
105 0.29
106 0.31
107 0.33
108 0.32
109 0.27
110 0.28
111 0.25
112 0.21
113 0.16
114 0.15
115 0.14
116 0.13
117 0.12
118 0.13
119 0.13
120 0.14
121 0.13
122 0.11
123 0.11
124 0.11
125 0.11
126 0.09
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.1
134 0.11
135 0.14
136 0.13
137 0.13
138 0.13
139 0.21