Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GN30

Protein Details
Accession A0A1Y2GN30    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-92YTMMLQCRTRQDRGRRIRNQWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 5, E.R. 5, extr 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHLPFVASSSLFSGLLKVQYFSVLYTFFGQMVKCITNNSTIKNTMRNQSLLPSTIALFLVYGTVALAFFTIYTMMLQCRTRQDRGRRIRNQW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.14
5 0.12
6 0.14
7 0.14
8 0.13
9 0.13
10 0.1
11 0.1
12 0.12
13 0.12
14 0.11
15 0.12
16 0.11
17 0.11
18 0.12
19 0.12
20 0.1
21 0.11
22 0.11
23 0.18
24 0.2
25 0.22
26 0.22
27 0.24
28 0.25
29 0.31
30 0.32
31 0.29
32 0.3
33 0.28
34 0.26
35 0.25
36 0.25
37 0.2
38 0.18
39 0.14
40 0.12
41 0.12
42 0.11
43 0.08
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.06
61 0.07
62 0.11
63 0.12
64 0.15
65 0.25
66 0.3
67 0.37
68 0.46
69 0.56
70 0.62
71 0.72
72 0.8