Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GIU1

Protein Details
Accession A0A1Y2GIU1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-92ASVPKSKTSHSKKRMRQATKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MSLLNIASRAVKPTSNLVILRAFSSYSVVRPTSSAFIINDNNNNTLSATNSSTTVLGRLGSYISDLLPSIVWASVPKSKTSHSKKRMRQATKGLKEQHNIVQCPGCGHAKLMHHLCMHCYRDMKGRGPSSRTLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.29
4 0.27
5 0.29
6 0.28
7 0.27
8 0.22
9 0.18
10 0.13
11 0.16
12 0.14
13 0.13
14 0.16
15 0.15
16 0.15
17 0.16
18 0.18
19 0.17
20 0.17
21 0.17
22 0.14
23 0.17
24 0.21
25 0.22
26 0.25
27 0.24
28 0.24
29 0.22
30 0.22
31 0.19
32 0.15
33 0.15
34 0.12
35 0.12
36 0.11
37 0.11
38 0.12
39 0.11
40 0.11
41 0.1
42 0.08
43 0.07
44 0.06
45 0.06
46 0.06
47 0.05
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.06
61 0.11
62 0.12
63 0.13
64 0.14
65 0.17
66 0.27
67 0.37
68 0.45
69 0.51
70 0.6
71 0.67
72 0.75
73 0.83
74 0.79
75 0.78
76 0.78
77 0.79
78 0.76
79 0.77
80 0.74
81 0.69
82 0.65
83 0.6
84 0.56
85 0.52
86 0.45
87 0.4
88 0.35
89 0.3
90 0.3
91 0.29
92 0.25
93 0.18
94 0.19
95 0.21
96 0.21
97 0.29
98 0.3
99 0.33
100 0.34
101 0.34
102 0.37
103 0.4
104 0.39
105 0.37
106 0.36
107 0.33
108 0.4
109 0.45
110 0.47
111 0.47
112 0.53
113 0.55
114 0.58