Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GWS1

Protein Details
Accession A0A1Y2GWS1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTFATRRTETRKKNKKKWTRDPDLPTYFNHydrophilic
NLS Segment(s)
PositionSequence
11-17RKKNKKK
Subcellular Location(s) mito 8, golg 8, plas 4, E.R. 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTFATRRTETRKKNKKKWTRDPDLPTYFNLLCDSFLYYFCFLFLFFFLNYHDASMIDIFDFNSNPIHLLDPSIRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.93
4 0.94
5 0.93
6 0.92
7 0.91
8 0.88
9 0.87
10 0.82
11 0.72
12 0.62
13 0.56
14 0.46
15 0.37
16 0.31
17 0.21
18 0.15
19 0.14
20 0.15
21 0.1
22 0.11
23 0.12
24 0.11
25 0.11
26 0.1
27 0.1
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.08
35 0.1
36 0.1
37 0.1
38 0.09
39 0.07
40 0.08
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.1
52 0.11
53 0.13
54 0.12
55 0.15