Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1Y2GCH4

Protein Details
Accession A0A1Y2GCH4    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-150DHENKKDYLKMRRKERKILDQMNEBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023091  MetalPrtase_cat_dom_sf_prd  
IPR002036  YbeY  
IPR020549  YbeY_CS  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0046872  F:metal ion binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0006508  P:proteolysis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF02130  YbeY  
PROSITE View protein in PROSITE  
PS01306  UPF0054  
Amino Acid Sequences MIRLINKQYIFRLDKPSIKKTIQMLITAAGYPNYDIGVMFTVDKTIRKLNREYRGKDKPTDILSFPFVEALKPGKLPKPQSVDERNLGDIVISMRYLDRWCGEHGVDINDRLPVLYAHGICHLLGYDHENKKDYLKMRRKERKILDQMNEWKAIIEEQNDSSSKAKSSRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.58
3 0.61
4 0.6
5 0.55
6 0.56
7 0.51
8 0.52
9 0.47
10 0.41
11 0.35
12 0.3
13 0.29
14 0.24
15 0.21
16 0.14
17 0.11
18 0.1
19 0.09
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.07
26 0.07
27 0.07
28 0.09
29 0.1
30 0.11
31 0.13
32 0.19
33 0.23
34 0.27
35 0.35
36 0.42
37 0.51
38 0.59
39 0.62
40 0.64
41 0.7
42 0.7
43 0.65
44 0.59
45 0.54
46 0.49
47 0.47
48 0.39
49 0.31
50 0.28
51 0.25
52 0.22
53 0.19
54 0.15
55 0.12
56 0.12
57 0.12
58 0.11
59 0.11
60 0.13
61 0.16
62 0.21
63 0.25
64 0.3
65 0.34
66 0.36
67 0.42
68 0.46
69 0.45
70 0.43
71 0.4
72 0.34
73 0.28
74 0.25
75 0.17
76 0.13
77 0.09
78 0.06
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.07
85 0.07
86 0.09
87 0.1
88 0.12
89 0.12
90 0.13
91 0.14
92 0.17
93 0.16
94 0.16
95 0.15
96 0.13
97 0.13
98 0.11
99 0.1
100 0.06
101 0.08
102 0.11
103 0.11
104 0.11
105 0.13
106 0.13
107 0.12
108 0.13
109 0.1
110 0.07
111 0.08
112 0.12
113 0.19
114 0.23
115 0.25
116 0.26
117 0.27
118 0.29
119 0.35
120 0.37
121 0.39
122 0.45
123 0.52
124 0.62
125 0.72
126 0.77
127 0.81
128 0.83
129 0.83
130 0.84
131 0.84
132 0.79
133 0.78
134 0.79
135 0.73
136 0.66
137 0.54
138 0.44
139 0.35
140 0.32
141 0.25
142 0.19
143 0.18
144 0.18
145 0.23
146 0.23
147 0.25
148 0.25
149 0.24
150 0.25