Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9NU62

Protein Details
Accession G9NU62    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
27-47MPKTTLTLKKRHRRCPREFLIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 11.333, nucl 8, cyto_nucl 5.333, golg 2
Family & Domain DBs
Amino Acid Sequences MQSDACTYPNHTSGLINSFTTGNFSIMPKTTLTLKKRHRRCPREFLIIPSLWIYHMPNLSWITRDVGLERQTVVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.18
4 0.17
5 0.16
6 0.15
7 0.17
8 0.15
9 0.12
10 0.11
11 0.12
12 0.13
13 0.13
14 0.14
15 0.12
16 0.12
17 0.17
18 0.23
19 0.26
20 0.33
21 0.43
22 0.51
23 0.6
24 0.69
25 0.74
26 0.77
27 0.82
28 0.83
29 0.79
30 0.8
31 0.72
32 0.66
33 0.62
34 0.52
35 0.44
36 0.35
37 0.28
38 0.19
39 0.19
40 0.15
41 0.12
42 0.13
43 0.12
44 0.16
45 0.18
46 0.18
47 0.18
48 0.18
49 0.18
50 0.19
51 0.19
52 0.18
53 0.22
54 0.24
55 0.23