Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GK57

Protein Details
Accession A0A1Y2GK57    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
29-53KTTTANSRTRRHKRSRHAGKQSGTSHydrophilic
NLS Segment(s)
PositionSequence
38-46RRHKRSRHA
Subcellular Location(s) mito 14, nucl 9, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MKTATLFLLSTLNLHVVDVMFMCNACETKTTTANSRTRRHKRSRHAGKQSGTSPLLRQVLRRSLLAHLKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.08
5 0.07
6 0.07
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.06
13 0.07
14 0.09
15 0.12
16 0.16
17 0.17
18 0.21
19 0.29
20 0.35
21 0.41
22 0.46
23 0.54
24 0.6
25 0.68
26 0.74
27 0.76
28 0.8
29 0.84
30 0.87
31 0.88
32 0.88
33 0.87
34 0.8
35 0.77
36 0.69
37 0.64
38 0.54
39 0.45
40 0.35
41 0.34
42 0.36
43 0.3
44 0.32
45 0.32
46 0.39
47 0.39
48 0.39
49 0.35
50 0.37