Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9P222

Protein Details
Accession G9P222   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
53-87VFNMFKRWKKNQTHESKPRKGRPKKSKPTPIETPTHydrophilic
NLS Segment(s)
PositionSequence
59-80RWKKNQTHESKPRKGRPKKSKP
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
Amino Acid Sequences MPEAQEPGAALISNRKRNHEFTAVQRAAICAQISEGKSYRVVAVEFNTSSSTVFNMFKRWKKNQTHESKPRKGRPKKSKPTPIETPTETKIQLLPDNSSVYVGKTVGGDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.45
4 0.5
5 0.56
6 0.54
7 0.5
8 0.49
9 0.58
10 0.52
11 0.47
12 0.43
13 0.38
14 0.3
15 0.28
16 0.2
17 0.09
18 0.1
19 0.14
20 0.14
21 0.17
22 0.17
23 0.16
24 0.16
25 0.17
26 0.16
27 0.13
28 0.13
29 0.11
30 0.11
31 0.13
32 0.12
33 0.13
34 0.12
35 0.11
36 0.11
37 0.1
38 0.09
39 0.08
40 0.1
41 0.1
42 0.15
43 0.21
44 0.25
45 0.32
46 0.39
47 0.46
48 0.53
49 0.62
50 0.67
51 0.71
52 0.77
53 0.8
54 0.84
55 0.84
56 0.85
57 0.84
58 0.85
59 0.85
60 0.86
61 0.86
62 0.88
63 0.89
64 0.91
65 0.92
66 0.89
67 0.87
68 0.85
69 0.78
70 0.74
71 0.66
72 0.61
73 0.52
74 0.49
75 0.41
76 0.33
77 0.3
78 0.27
79 0.27
80 0.24
81 0.25
82 0.24
83 0.27
84 0.26
85 0.26
86 0.22
87 0.19
88 0.19
89 0.16
90 0.14