Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GQ59

Protein Details
Accession A0A1Y2GQ59    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
498-525MMHLIDKKTGRKSKKPPQFLKKGQQGIVHydrophilic
NLS Segment(s)
PositionSequence
93-109APKAPTAEAPKKKVEAA
505-514KTGRKSKKPP
Subcellular Location(s) cyto 24.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004161  EFTu-like_2  
IPR031157  G_TR_CS  
IPR027417  P-loop_NTPase  
IPR003285  Sup35  
IPR000795  T_Tr_GTP-bd_dom  
IPR009000  Transl_B-barrel_sf  
IPR009001  Transl_elong_EF1A/Init_IF2_C  
IPR004160  Transl_elong_EFTu/EF1A_C  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0003747  F:translation release factor activity  
GO:0000288  P:nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay  
Pfam View protein in Pfam  
PF00009  GTP_EFTU  
PF03144  GTP_EFTU_D2  
PF03143  GTP_EFTU_D3  
PROSITE View protein in PROSITE  
PS00301  G_TR_1  
PS51722  G_TR_2  
CDD cd01883  EF1_alpha  
cd03704  eRF3_C_III  
cd04089  eRF3_II  
Amino Acid Sequences MPQPAAEAPPAPPTSSGIDFNRPPPAAVLNKTVETSSSDSAPAPTAATLDFNRPPPAAVLNKTVDTTPAAPKPVPAAAAAAAAAPVAKPASPAPKAPTAEAPKKKVEAAPKAPAAAPPAPVEEEEDAVDQETLTEFFGKEHVNVIFIGHVDAGKSTMGGRILEATGMIDKRTLEKYEKDAKEAGRDSWYLSWALDTNAEERAKGKTVECGRAYFETDTRRYTILDAPGHKTYVPSMIGGAAQADCAVLVISARKGEFETGFENGGQTREHAQLAKSGGVNKLVVVINKMDDPTVSWSKERYDECVSKLTPFLKGSGFNMKTDVMFMPVSGFTGANIKADLDASICDWYKGPSLLGYLDSLKLADRNFSAPLRMPISEKYKDMGTVVVGKIESGSLKKGANLLMMPNGSKVEVQAIFNELEEEIPAAAVGDNIRLRLRNIEEEDIMIGFVLCSPKNPVHAVSKFEAQLGILDHKNIICAGYTAVLHIHNAIEEITLSAMMHLIDKKTGRKSKKPPQFLKKGQQGIVMIETTGPLCMETFTDSPRMGRFTLRDEGKTIAIGKVTKLITDDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.33
4 0.29
5 0.35
6 0.37
7 0.4
8 0.46
9 0.41
10 0.38
11 0.35
12 0.38
13 0.37
14 0.37
15 0.4
16 0.36
17 0.37
18 0.37
19 0.35
20 0.29
21 0.27
22 0.27
23 0.23
24 0.2
25 0.2
26 0.2
27 0.21
28 0.22
29 0.18
30 0.14
31 0.13
32 0.12
33 0.11
34 0.15
35 0.15
36 0.19
37 0.23
38 0.25
39 0.28
40 0.27
41 0.28
42 0.26
43 0.31
44 0.32
45 0.31
46 0.35
47 0.35
48 0.36
49 0.36
50 0.34
51 0.28
52 0.25
53 0.25
54 0.25
55 0.26
56 0.28
57 0.27
58 0.28
59 0.3
60 0.29
61 0.26
62 0.2
63 0.18
64 0.15
65 0.15
66 0.14
67 0.1
68 0.08
69 0.07
70 0.07
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.1
77 0.18
78 0.21
79 0.24
80 0.28
81 0.35
82 0.37
83 0.38
84 0.43
85 0.44
86 0.52
87 0.57
88 0.57
89 0.54
90 0.55
91 0.55
92 0.51
93 0.51
94 0.51
95 0.51
96 0.53
97 0.5
98 0.5
99 0.48
100 0.45
101 0.41
102 0.33
103 0.27
104 0.21
105 0.21
106 0.2
107 0.2
108 0.21
109 0.17
110 0.15
111 0.14
112 0.14
113 0.12
114 0.12
115 0.11
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.07
122 0.07
123 0.07
124 0.1
125 0.11
126 0.11
127 0.14
128 0.13
129 0.13
130 0.13
131 0.13
132 0.11
133 0.1
134 0.11
135 0.07
136 0.07
137 0.06
138 0.06
139 0.07
140 0.06
141 0.06
142 0.06
143 0.08
144 0.09
145 0.09
146 0.09
147 0.1
148 0.1
149 0.1
150 0.09
151 0.08
152 0.09
153 0.1
154 0.1
155 0.09
156 0.09
157 0.13
158 0.15
159 0.18
160 0.19
161 0.22
162 0.29
163 0.39
164 0.39
165 0.39
166 0.41
167 0.39
168 0.43
169 0.41
170 0.36
171 0.28
172 0.28
173 0.27
174 0.24
175 0.24
176 0.17
177 0.15
178 0.14
179 0.11
180 0.11
181 0.11
182 0.1
183 0.1
184 0.15
185 0.15
186 0.14
187 0.14
188 0.16
189 0.17
190 0.17
191 0.17
192 0.19
193 0.24
194 0.31
195 0.31
196 0.3
197 0.3
198 0.3
199 0.33
200 0.27
201 0.25
202 0.24
203 0.25
204 0.25
205 0.25
206 0.24
207 0.22
208 0.22
209 0.23
210 0.23
211 0.26
212 0.26
213 0.29
214 0.29
215 0.29
216 0.27
217 0.23
218 0.18
219 0.17
220 0.15
221 0.11
222 0.1
223 0.1
224 0.1
225 0.09
226 0.09
227 0.05
228 0.05
229 0.04
230 0.04
231 0.03
232 0.03
233 0.03
234 0.02
235 0.03
236 0.04
237 0.04
238 0.05
239 0.05
240 0.06
241 0.06
242 0.08
243 0.08
244 0.09
245 0.1
246 0.11
247 0.11
248 0.11
249 0.11
250 0.1
251 0.1
252 0.08
253 0.08
254 0.1
255 0.11
256 0.12
257 0.12
258 0.12
259 0.14
260 0.16
261 0.16
262 0.14
263 0.15
264 0.15
265 0.15
266 0.15
267 0.11
268 0.14
269 0.12
270 0.12
271 0.11
272 0.1
273 0.1
274 0.1
275 0.11
276 0.07
277 0.06
278 0.07
279 0.12
280 0.15
281 0.15
282 0.15
283 0.16
284 0.18
285 0.24
286 0.23
287 0.22
288 0.25
289 0.26
290 0.28
291 0.32
292 0.3
293 0.26
294 0.28
295 0.24
296 0.21
297 0.19
298 0.19
299 0.15
300 0.16
301 0.17
302 0.24
303 0.25
304 0.21
305 0.22
306 0.21
307 0.2
308 0.2
309 0.18
310 0.11
311 0.1
312 0.09
313 0.09
314 0.08
315 0.09
316 0.08
317 0.08
318 0.06
319 0.09
320 0.09
321 0.08
322 0.08
323 0.08
324 0.07
325 0.08
326 0.08
327 0.05
328 0.05
329 0.06
330 0.08
331 0.08
332 0.08
333 0.08
334 0.09
335 0.1
336 0.11
337 0.1
338 0.08
339 0.09
340 0.09
341 0.1
342 0.1
343 0.09
344 0.09
345 0.09
346 0.09
347 0.08
348 0.09
349 0.09
350 0.09
351 0.09
352 0.11
353 0.13
354 0.14
355 0.15
356 0.15
357 0.19
358 0.19
359 0.19
360 0.19
361 0.22
362 0.28
363 0.29
364 0.28
365 0.26
366 0.24
367 0.23
368 0.22
369 0.18
370 0.12
371 0.15
372 0.14
373 0.14
374 0.13
375 0.12
376 0.12
377 0.12
378 0.12
379 0.08
380 0.1
381 0.11
382 0.11
383 0.12
384 0.14
385 0.15
386 0.15
387 0.15
388 0.14
389 0.15
390 0.16
391 0.15
392 0.14
393 0.13
394 0.12
395 0.11
396 0.1
397 0.12
398 0.13
399 0.13
400 0.13
401 0.15
402 0.14
403 0.14
404 0.15
405 0.1
406 0.08
407 0.08
408 0.08
409 0.05
410 0.05
411 0.04
412 0.04
413 0.04
414 0.05
415 0.05
416 0.08
417 0.09
418 0.1
419 0.12
420 0.12
421 0.14
422 0.19
423 0.22
424 0.26
425 0.29
426 0.31
427 0.3
428 0.3
429 0.29
430 0.24
431 0.2
432 0.13
433 0.08
434 0.05
435 0.06
436 0.08
437 0.08
438 0.09
439 0.14
440 0.16
441 0.19
442 0.21
443 0.23
444 0.3
445 0.33
446 0.37
447 0.35
448 0.38
449 0.35
450 0.34
451 0.3
452 0.21
453 0.2
454 0.18
455 0.19
456 0.15
457 0.15
458 0.16
459 0.16
460 0.16
461 0.15
462 0.12
463 0.08
464 0.08
465 0.09
466 0.09
467 0.09
468 0.09
469 0.11
470 0.11
471 0.11
472 0.11
473 0.1
474 0.08
475 0.09
476 0.08
477 0.07
478 0.07
479 0.07
480 0.06
481 0.06
482 0.06
483 0.06
484 0.06
485 0.06
486 0.08
487 0.1
488 0.11
489 0.15
490 0.19
491 0.26
492 0.35
493 0.44
494 0.5
495 0.59
496 0.69
497 0.75
498 0.82
499 0.87
500 0.88
501 0.89
502 0.92
503 0.91
504 0.91
505 0.9
506 0.87
507 0.78
508 0.73
509 0.64
510 0.55
511 0.48
512 0.38
513 0.28
514 0.2
515 0.18
516 0.13
517 0.12
518 0.09
519 0.06
520 0.06
521 0.07
522 0.08
523 0.12
524 0.13
525 0.16
526 0.2
527 0.2
528 0.22
529 0.25
530 0.27
531 0.24
532 0.28
533 0.29
534 0.31
535 0.4
536 0.42
537 0.41
538 0.4
539 0.42
540 0.37
541 0.37
542 0.33
543 0.25
544 0.25
545 0.24
546 0.22
547 0.26
548 0.25
549 0.23
550 0.23