Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9P8U7

Protein Details
Accession G9P8U7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-68GGVRKEKKSEYRQYMNRQGGFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MDQDDYDEDIEVQGQGDDDDGLAAMQSMMGFGGFGTTKGKKVAGNNAGGVRKEKKSEYRQYMNRQGGFNRPLSPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.04
7 0.04
8 0.04
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.03
15 0.02
16 0.02
17 0.02
18 0.02
19 0.04
20 0.03
21 0.04
22 0.07
23 0.08
24 0.09
25 0.1
26 0.12
27 0.13
28 0.15
29 0.24
30 0.25
31 0.26
32 0.28
33 0.31
34 0.32
35 0.31
36 0.32
37 0.27
38 0.25
39 0.27
40 0.3
41 0.35
42 0.42
43 0.52
44 0.57
45 0.63
46 0.7
47 0.76
48 0.82
49 0.8
50 0.75
51 0.68
52 0.62
53 0.6
54 0.56
55 0.49
56 0.43