Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1Y2GJT2

Protein Details
Accession A0A1Y2GJT2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
57-76EDLAERKKRGQGRRSTLKKKBasic
NLS Segment(s)
PositionSequence
61-76ERKKRGQGRRSTLKKK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences ATNKLALLNKISCAIFGNVYNPQNIQRRLIGPTINSYYPNVKQIKLREITRMKTRLEDLAERKKRGQGRRSTLKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.17
3 0.16
4 0.18
5 0.2
6 0.21
7 0.21
8 0.2
9 0.24
10 0.3
11 0.31
12 0.31
13 0.28
14 0.29
15 0.31
16 0.32
17 0.27
18 0.2
19 0.23
20 0.24
21 0.21
22 0.2
23 0.19
24 0.2
25 0.19
26 0.25
27 0.22
28 0.21
29 0.24
30 0.27
31 0.33
32 0.35
33 0.36
34 0.39
35 0.42
36 0.46
37 0.5
38 0.51
39 0.45
40 0.43
41 0.44
42 0.39
43 0.38
44 0.4
45 0.4
46 0.46
47 0.53
48 0.53
49 0.54
50 0.56
51 0.6
52 0.62
53 0.64
54 0.64
55 0.67
56 0.74